close all open/close all

CDS information : Balhi_00130


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction37,353 / 38,573 / + [in whole cluster]
37,353 / 38,573 / + [in contig]
Location37353..38573 [in whole cluster]
37353..38573 [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)P450 monooxygenase
Gene
Gene (GenBank)oxyC
EC number
Keyword
  • 3rd cross-linking
  • AB ring
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
[12404385] The Biosynthesis of Vancomycin-Type Glycopeptide Antibiotics-The Order of the Cyclization Steps This work was supported by the Deutsche Forschungsgemeinschaft (SFB 323) and by a grant of the EU (MEGATOP, QLK3-1999-00650). R. D. S. gratefully acknowledges the support of a Feodor-Lynen Fellowship granted by the Alexander-von-Humboldt Stiftung. We thank Corina Bihlmaier and Volker Pfeifer for help with transformation and Southern hybridization, J. A. Moss (La Jolla (USA)) for critical comments on the manuscript and Prof. Dr. M. E. Maier and Prof. Dr. H.-P. Fiedler (Tubingen) for generous support. (Angew Chem Int Ed Engl. , 2001)
[15137740] Mutasynthesis of glycopeptide antibiotics: variations of vancomycin's AB-ring amino acid 3,5-dihydroxyphenylglycine. (J Am Chem Soc. , 2004)
[16730832] Genetic analysis of the balhimycin (vancomycin-type) oxygenase genes. (J Biotechnol. , 2006)

close this sectionSequence

selected fasta
>cytochrome P450 [P450 monooxygenase]
MGHDIGQLAPLLPEPANFQLRTNCDPHADNFDLRAHGPLVRIAGDSSAQLGREYVWQAHG
YDVVRRILGDHENFTTRPQFTQAKSGAHVEAQFVGQISTYDPPEHTRLRKMLTPEFTVRR
IRRMEPAIQALVDDRLDRVAAEGPPADLQALFADPVGALALCELLGIPRDDQREFVRRIR
RNTDLSRGLKARAADSAAFNRYLDNLIARQRRDADDGFLGMIVREHGDTVTDEELKGLCT
ALILGGVETVAGMIGFGVLALLENPGQVPLLFAGPEQADRVVNELLRYLSPVQAPNPSLA
VKDVIIDGQLIKAGDYVLCSVLMANRDEALTPNPNVFDANRAAVSDVGFGHGIHYCVGAA
LARSMLRMAYQALWQRFPGLRLAVPIAEVKYRSAFVDCPDRVPVTW
selected fasta
>cytochrome P450 [P450 monooxygenase]
ATGGGGCACGATATCGGTCAGCTCGCGCCGCTCTTGCCGGAGCCGGCGAACTTCCAGCTG
AGGACGAACTGCGATCCGCATGCGGACAACTTCGACCTGAGGGCGCACGGCCCGCTGGTC
CGGATAGCCGGGGACTCCTCCGCTCAGCTGGGCAGGGAATATGTCTGGCAGGCCCACGGC
TACGACGTCGTGCGCCGGATATTGGGCGACCACGAGAATTTCACGACGCGGCCGCAATTC
ACCCAAGCGAAATCCGGGGCGCACGTCGAGGCCCAGTTCGTCGGGCAGATATCGACCTAC
GACCCACCCGAGCACACCCGGCTGCGGAAGATGCTCACGCCGGAGTTCACGGTCCGGCGG
ATCCGCCGGATGGAGCCCGCGATCCAAGCCCTCGTCGACGATCGGCTCGACCGGGTGGCG
GCCGAGGGACCGCCCGCCGACCTCCAGGCGCTGTTCGCCGACCCGGTCGGCGCGCTCGCT
CTGTGCGAACTGCTCGGCATCCCCCGAGACGACCAGCGCGAGTTCGTCCGGCGGATCAGG
CGGAACACCGATCTGAGCCGCGGGCTCAAGGCGCGGGCGGCGGACAGCGCGGCGTTCAAC
CGGTACCTGGACAACCTCATCGCCCGGCAGCGCCGGGACGCCGACGACGGGTTCCTCGGC
ATGATCGTGCGAGAGCACGGGGACACCGTCACGGACGAGGAGCTGAAGGGCCTGTGCACG
GCGCTGATCCTCGGCGGCGTCGAGACCGTCGCCGGGATGATCGGCTTCGGGGTGCTCGCC
CTGCTCGAGAACCCCGGCCAGGTGCCGTTGCTGTTCGCGGGCCCCGAGCAGGCCGACCGC
GTGGTCAACGAGCTGCTGCGTTACCTGTCTCCGGTGCAGGCGCCGAATCCCAGCCTCGCC
GTCAAGGATGTGATCATCGACGGACAGCTGATCAAAGCGGGAGATTATGTCCTGTGCTCG
GTCCTCATGGCCAACCGGGACGAAGCGCTGACGCCGAACCCCAACGTCTTCGACGCGAAT
CGCGCCGCGGTATCGGACGTCGGTTTCGGGCACGGCATCCACTACTGCGTGGGCGCGGCG
CTGGCCAGGTCGATGCTGCGGATGGCGTACCAGGCCCTGTGGCAGCGATTCCCCGGGCTC
CGGCTGGCCGTGCCCATCGCGGAAGTGAAGTACCGAAGCGCGTTCGTCGACTGCCCTGAT
CGGGTTCCGGTCACCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [245-262]  7.80000016938413e-05 PR00385 [280-291]  7.80000016938413e-05 PR00385 [347-356]  7.80000016938413e-05 PR00385 [356-367]  7.80000016938413e-05 PR00385
PR00385   P450
 [3-406]  2.2999842048857e-92 SSF48264
SSF48264   Cytochrome_P450
 [10-406]  5.40000000000002e-91 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [279-377]  9.30000000000002e-13 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [100-111]  4.39999001237725e-44 PR00359 [147-163]  4.39999001237725e-44 PR00359 [164-179]  4.39999001237725e-44 PR00359 [201-223]  4.39999001237725e-44 PR00359 [280-291]  4.39999001237725e-44 PR00359 [298-325]  4.39999001237725e-44 PR00359 [326-341]  4.39999001237725e-44 PR00359 [347-356]  4.39999001237725e-44 PR00359 [356-367]  4.39999001237725e-44 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [349-358]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit