close all open/close all

CDS information : Balhi_00140


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction38,634 / 40,109 / + [in whole cluster]
38,634 / 40,109 / + [in contig]
Location38634..40109 [in whole cluster]
38634..40109 [in contig]
TypeCDS
Length1,476 bp (491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Producthalogenase
Product (GenBank)halogenase
Gene
Gene (GenBank)bhaA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
Related Reference
ACC
G4V4R7
NITE
Vanco_00150
PmId
[24756572] Bis-chlorination of a hexapeptide-PCP conjugate by the halogenase involved in vancomycin biosynthesis. (Org Biomol Chem. , 2014)
ACC
R4T052
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)
ACC
Q7WZ81
NITE
A4092_00160
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>halogenase [halogenase]
MSVEDFDVVVAGGGPGGSTVATLVAMQGHRVLLLEKEVFPRYQIGESLLPATVHGVCRML
GISDELANAGFPIKRGGTFRWGARPEPWTFHFGISAKMAGSTSHAYQVERARFDEMLLNN
AKRKGVVVREGCAVTDVVEDGERVTGARYTDPDGTEREVSARFVIDASGNKSRLYTKVGG
SRNYSEFFRSLALFGYFEGGKRLPEPVSGNILSVAFDSGWFWYIPLSDTLTSVGAVVRRE
DAEKIQGDREKALNTLIAECPLISEYLADATRVTTGRYGELRVRKDYSYQQETYWRPGMI
LVGDAACFVDPVFSSGVHLATYSALLAARSINSVLAGDLDEKTALNEFELRYRREYGVFY
EFLVSFYQMNVNEESYFWQAKKVTQNQSTDVESFVELIGGVSSGETALTAADRIAARSAE
FAAAVDEMAGGDGDNMVPMFKSTVVQQAMQEAGQVQMKALLGEDAEPELPLFPGGLVTSP
ERMKWLPHHPA
selected fasta
>halogenase [halogenase]
ATGTCGGTCGAAGACTTCGACGTGGTGGTGGCGGGCGGCGGGCCGGGTGGTTCGACGGTG
GCCACGCTGGTGGCCATGCAGGGACACCGGGTGCTGCTGCTGGAGAAAGAGGTTTTCCCG
CGGTATCAGATCGGTGAGTCGCTGCTGCCCGCCACGGTGCACGGCGTGTGCCGGATGCTC
GGCATCTCCGACGAGCTGGCCAATGCCGGGTTCCCGATCAAGCGCGGCGGCACGTTCCGC
TGGGGCGCCCGGCCGGAGCCGTGGACGTTCCACTTCGGCATCTCGGCCAAGATGGCCGGC
TCGACGTCGCACGCCTACCAGGTCGAGCGGGCGCGGTTCGACGAGATGCTGCTGAACAAC
GCCAAGCGCAAGGGCGTGGTCGTGCGGGAGGGGTGCGCGGTCACCGATGTGGTGGAAGAC
GGCGAGCGGGTCACCGGTGCGCGGTACACCGATCCCGACGGCACCGAGCGGGAAGTGTCG
GCGCGGTTCGTGATCGACGCGTCGGGCAACAAGAGCCGGCTCTACACCAAGGTCGGCGGT
TCGCGGAACTATTCGGAGTTCTTCCGCAGCCTCGCGCTGTTCGGTTACTTCGAGGGTGGC
AAGCGGCTGCCCGAGCCGGTCTCCGGGAACATCCTGAGTGTGGCCTTCGACAGCGGCTGG
TTCTGGTACATCCCGCTGAGCGACACGCTGACCAGCGTCGGCGCGGTGGTGCGCCGGGAG
GACGCCGAGAAGATCCAGGGTGACCGGGAGAAGGCCCTCAACACGCTGATCGCCGAGTGC
CCGCTGATCTCGGAATACCTCGCGGACGCGACCCGGGTGACGACCGGCCGGTACGGGGAA
CTGCGCGTCCGCAAGGACTACTCCTACCAGCAGGAGACCTACTGGCGGCCGGGCATGATC
CTGGTCGGCGACGCCGCGTGTTTCGTGGACCCGGTGTTCTCCTCCGGTGTGCACCTGGCG
ACCTACAGCGCGCTGCTCGCGGCCCGGTCGATCAACAGCGTCCTCGCCGGCGACCTGGAC
GAGAAGACCGCGCTGAACGAGTTCGAGCTGCGGTATCGCCGTGAGTACGGCGTGTTCTAC
GAGTTCCTCGTGTCCTTCTACCAGATGAACGTGAACGAGGAGTCGTACTTCTGGCAGGCC
AAGAAGGTCACGCAGAACCAGAGCACCGACGTCGAGTCGTTCGTCGAGCTGATCGGCGGA
GTGTCGTCCGGGGAGACCGCGCTGACGGCCGCCGACCGCATCGCCGCGCGCAGTGCCGAG
TTCGCCGCGGCGGTGGACGAGATGGCGGGCGGGGACGGCGACAACATGGTGCCGATGTTC
AAGTCGACGGTGGTCCAGCAGGCGATGCAGGAAGCGGGCCAGGTGCAGATGAAGGCGCTG
CTCGGCGAGGACGCCGAACCCGAGCTGCCCCTGTTCCCCGGTGGCCTGGTGACCTCGCCC
GAACGGATGAAGTGGCTGCCTCACCACCCTGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  1.19999985703101e-07 PR00420 [160-175]  1.19999985703101e-07 PR00420 [296-311]  1.19999985703101e-07 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [7-95]  6.1e-24 PF04820 [99-402]  1.69999999999998e-74 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit