close all open/close all

CDS information : Balhi_00150


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction40,192 / 41,382 / + [in whole cluster]
40,192 / 41,382 / + [in contig]
Location40192..41382 [in whole cluster]
40192..41382 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)bgtfA
EC number
Keyword
  • dehydrovancosamine
  • Bht6
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
[12874381] Structure of the TDP-epi-vancosaminyltransferase GtfA from the chloroeremomycin biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2003)
Related Reference
ACC
P96558
NITE
Chlor_00120
PmId
[9115410] Production of hybrid glycopeptide antibiotics in vitro and in Streptomyces toyocaensis. (Chem Biol. , 1997)
[12874381] Structure of the TDP-epi-vancosaminyltransferase GtfA from the chloroeremomycin biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2003)
[15070728] Characterization of a regiospecific epivancosaminyl transferase GtfA and enzymatic reconstitution of the antibiotic chloroeremomycin. (Proc Natl Acad Sci U S A. , 2004)
[16045364] A systematic investigation of the synthetic utility of glycopeptide glycosyltransferases. (J Am Chem Soc. , 2005)
[19549605] Chimeric glycosyltransferases for the generation of hybrid glycopeptides. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase]
MRVLISGCGSRGDTEPLIALAVRLRELGVDVRMCLPPDYVERCAEVGVSMVAVGPAMRAG
ARGPGEPPPGAPEIVSEVVADWFDKVPAAAEGCDVVVATGLLPAAVVVRSVAEKLGIPYL
YTVLSPDHLPSVLSQAERDEYDQGADRLFGAVVTSGRAAIGLPPVANLFTYGYTEQPWLG
ADQILAPPPPGDLDTVQTGAWILPDERPLPAELETFLAAGSPPVYVGFGSSSGPRTAGAA
KAAIEAIRARGHRVVLSRGWADLAAPDDSADCFTVGEVNLQVLFRRVAAAVHHDSAGTTL
LAIRAGTPQIVVRRVIDNVVEQAYHADRVAELGVGVALEGPIPASEAMSDALETALAPET
RARAAEVAGTVRTDGTTVAAELLFAAVSREKPAVPA
selected fasta
>glycosyltransferase [glycosyltransferase]
ATGCGCGTGTTGATCTCGGGGTGCGGATCGCGCGGGGACACCGAACCGCTGATCGCCTTG
GCGGTCCGGTTGCGGGAACTCGGTGTAGACGTCCGGATGTGCCTGCCGCCGGACTACGTG
GAGCGGTGCGCCGAGGTCGGGGTGTCGATGGTGGCGGTCGGCCCGGCGATGCGCGCCGGG
GCACGCGGGCCGGGAGAACCGCCGCCGGGAGCACCCGAAATCGTGTCCGAGGTGGTCGCG
GACTGGTTCGACAAGGTGCCGGCGGCCGCCGAAGGGTGTGACGTGGTGGTGGCGACCGGC
TTGCTGCCCGCCGCGGTCGTCGTGCGGTCGGTCGCCGAGAAGCTGGGCATCCCTTACCTC
TACACCGTGCTGTCGCCGGACCACCTGCCGTCGGTGCTCAGCCAGGCGGAGCGCGACGAA
TACGACCAGGGCGCCGACCGGCTGTTCGGTGCGGTGGTCACCAGCGGGCGGGCCGCGATC
GGCCTGCCGCCGGTGGCGAACCTCTTCACCTACGGCTACACCGAACAGCCCTGGCTGGGG
GCGGACCAGATCCTCGCCCCGCCGCCACCGGGAGACTTGGACACCGTGCAGACCGGTGCG
TGGATCCTGCCCGACGAACGGCCCCTTCCCGCGGAGCTGGAGACGTTCCTCGCGGCCGGG
TCGCCGCCCGTGTACGTGGGTTTCGGCAGCTCGTCCGGACCCCGGACCGCCGGCGCCGCC
AAGGCGGCCATCGAGGCGATCCGCGCCCGGGGCCACCGGGTCGTCCTCTCCCGCGGCTGG
GCCGACCTGGCCGCGCCCGACGACTCGGCCGACTGCTTCACCGTCGGCGAAGTGAACCTC
CAGGTGCTGTTCCGCCGGGTGGCCGCCGCCGTCCACCACGACAGCGCGGGCACGACACTC
CTGGCCATCCGGGCAGGCACCCCCCAGATCGTCGTCCGCCGCGTGATAGACAACGTGGTG
GAGCAGGCGTACCACGCCGACCGGGTGGCCGAACTGGGGGTCGGTGTGGCACTCGAAGGT
CCGATCCCGGCCTCCGAGGCCATGTCGGACGCGCTCGAGACGGCGCTGGCACCGGAAACC
CGCGCGCGAGCGGCGGAGGTGGCGGGCACGGTCCGCACCGACGGGACGACGGTGGCCGCG
GAACTGCTGTTCGCCGCGGTCAGCCGGGAAAAGCCCGCCGTTCCCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-133]  9.20000000000002e-26 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit