close all open/close all

CDS information : Balhi_00160


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction41,447 / 42,676 / + [in whole cluster]
41,447 / 42,676 / + [in contig]
Location41447..42676 [in whole cluster]
41447..42676 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)bgtfB
EC number2.4.1.310
Keyword
  • D-glucose
  • Hpg4
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
Related Reference
ACC
P96559
NITE
Chlor_00130
PmId
[9115410] Production of hybrid glycopeptide antibiotics in vitro and in Streptomyces toyocaensis. (Chem Biol. , 1997)
[11294642] Tandem action of glycosyltransferases in the maturation of vancomycin and teicoplanin aglycones: novel glycopeptides. (Biochemistry. , 2001)
[11470430] Structure of the UDP-glucosyltransferase GtfB that modifies the heptapeptide aglycone in the biosynthesis of vancomycin group antibiotics. (Structure. , 2001)
[19549605] Chimeric glycosyltransferases for the generation of hybrid glycopeptides. (Chem Biol. , 2009)
ACC
G4V4R9
NITE
Vanco_00170
PmId
[11294642] Tandem action of glycosyltransferases in the maturation of vancomycin and teicoplanin aglycones: novel glycopeptides. (Biochemistry. , 2001)
[12498883] Incorporation of glucose analogs by GtfE and GtfD from the vancomycin biosynthetic pathway to generate variant glycopeptides. (Chem Biol. , 2002)
[16946071] Exploiting the reversibility of natural product glycosyltransferase-catalyzed reactions. (Science. , 2006)
[24954524] Enzymatic glycosylation of vancomycin aglycon: completion of a total synthesis of vancomycin and N- and C-terminus substituent effects of the aglycon substrate. (Org Lett. , 2014)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MKRVLLSTLGSRGDVEPLVALAVRLRDLGAEPLMCAPPDCADRLEEVGVPHVPVGPSARA
PIHREKPLTPEDMRRLMAEAIAMPFDRIPAAAEGCAAVVTTGLLAAAIGVRSVAEKLGIP
YFYAFHCPSYVPSPYYPPPPPLGEPPAEDVTDIRALWERNNRSAYQRYGGPLNSHRAAIG
LPPVEDIFTFGYTDHPWVAADSVLAPMQPTDLGAVQTGAWILPDERPLSPELEAFLDTGT
PPVYLGFGSLRAPADAVRVSIDAIRAQGRRVILSRGWADLVLPDDREDCFATGEVNQQVL
FGRVAAVIHHGGAGTTHVAMQAGAPQVLVPQMADQPYYAGRVAELGIGVAHDGPVPTFDS
LSAALVTALAPETRARAEAVARTAGADGAAVAAKLLLDAVSREKPAVPA
selected fasta
>putative glycosyltransferase [glycosyltransferase]
GTGAAGCGTGTGCTGTTGTCGACGCTCGGAAGCCGCGGAGACGTCGAACCACTGGTGGCC
TTGGCGGTCCGGCTGCGCGACCTCGGCGCGGAGCCGCTGATGTGCGCACCGCCGGACTGC
GCGGACCGGCTGGAAGAGGTCGGCGTGCCGCACGTGCCCGTCGGCCCGTCGGCGCGCGCG
CCGATCCATCGGGAGAAGCCGTTGACGCCCGAGGACATGCGCCGGCTCATGGCCGAAGCG
ATCGCCATGCCGTTCGACCGGATACCGGCGGCCGCCGAGGGGTGTGCCGCAGTGGTGACG
ACCGGGCTGCTGGCCGCCGCGATCGGCGTGCGGTCGGTGGCCGAGAAGCTGGGCATCCCC
TACTTCTACGCCTTCCACTGCCCGAGCTACGTGCCGTCACCGTACTATCCGCCGCCACCG
CCCCTCGGCGAGCCGCCCGCCGAGGACGTGACCGACATCCGGGCGCTGTGGGAGCGGAAC
AACCGGAGCGCTTACCAGCGGTACGGGGGTCCGCTCAACAGCCACCGGGCCGCGATCGGC
CTGCCTCCGGTGGAGGACATCTTCACCTTCGGCTACACCGATCACCCGTGGGTGGCGGCG
GATTCGGTCCTGGCCCCGATGCAGCCGACCGACCTCGGTGCCGTGCAGACCGGCGCGTGG
ATCCTGCCCGACGAACGGCCGCTTTCCCCGGAGCTGGAAGCTTTCCTGGACACCGGCACC
CCGCCGGTGTACCTCGGGTTCGGCAGCCTGCGCGCCCCGGCCGACGCCGTCCGGGTGTCC
ATCGACGCGATCCGGGCCCAAGGCCGCCGGGTAATCCTTTCCCGGGGCTGGGCCGACCTG
GTCCTGCCCGACGACCGGGAAGACTGCTTCGCCACCGGCGAGGTGAACCAGCAGGTGCTG
TTCGGCCGGGTGGCCGCCGTCATCCACCACGGCGGCGCGGGCACGACGCACGTGGCCATG
CAGGCCGGGGCACCCCAGGTCCTGGTGCCCCAGATGGCGGACCAGCCGTACTACGCCGGC
CGGGTGGCCGAGCTGGGGATCGGGGTGGCCCACGACGGTCCGGTCCCGACCTTCGACTCG
CTGTCGGCCGCGCTCGTCACGGCGCTGGCCCCGGAAACCCGCGCACGAGCGGAGGCCGTG
GCGCGCACGGCCGGTGCCGACGGGGCGGCGGTGGCCGCGAAACTGCTGCTCGACGCGGTC
AGCCGGGAAAAGCCGGCTGTTCCCGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [4-135]  1.1e-26 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit