close all open/close all

CDS information : Balhi_00170


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction42,824 / 44,053 / + [in whole cluster]
42,824 / 44,053 / + [in contig]
Location42824..44053 [in whole cluster]
42824..44053 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)bgtfC
EC number
Keyword
  • derivative
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
Related Reference
ACC
P96560
NITE
Chlor_00140
PmId
[11294642] Tandem action of glycosyltransferases in the maturation of vancomycin and teicoplanin aglycones: novel glycopeptides. (Biochemistry. , 2001)
[15070728] Characterization of a regiospecific epivancosaminyl transferase GtfA and enzymatic reconstitution of the antibiotic chloroeremomycin. (Proc Natl Acad Sci U S A. , 2004)
[16045364] A systematic investigation of the synthetic utility of glycopeptide glycosyltransferases. (J Am Chem Soc. , 2005)
ACC
G4V4R8
NITE
Vanco_00160
PmId
[11294642] Tandem action of glycosyltransferases in the maturation of vancomycin and teicoplanin aglycones: novel glycopeptides. (Biochemistry. , 2001)
[12498883] Incorporation of glucose analogs by GtfE and GtfD from the vancomycin biosynthetic pathway to generate variant glycopeptides. (Chem Biol. , 2002)
[15122882] Crystal structure of vancosaminyltransferase GtfD from the vancomycin biosynthetic pathway: interactions with acceptor and nucleotide ligands. (Biochemistry. , 2004)
[16045364] A systematic investigation of the synthetic utility of glycopeptide glycosyltransferases. (J Am Chem Soc. , 2005)
[16946071] Exploiting the reversibility of natural product glycosyltransferase-catalyzed reactions. (Science. , 2006)
[24954524] Enzymatic glycosylation of vancomycin aglycon: completion of a total synthesis of vancomycin and N- and C-terminus substituent effects of the aglycon substrate. (Org Lett. , 2014)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MRVLLSTAGSRGDVEPLLALAVRLQGLGAEVLMCASPASAERLAEVGVPHVPVGLQLDGM
LLQEGMPPPSAEDERRLAAMAIDMQFDAVPAAAEGCAAVVATGELAAAAAVRSVAEKLGI
PYFYGAYSPNYLASPHYPPPDDERTTPGVTDNGVLWAERAERFAKRYGETLNSRRAAIGL
PPVADVFGYGYTEQPWLAADPVLAPLDPDLDAVQTGAWILRDDRPLSPELAAFLAAGSPP
VYVGFGSASGPGIEDAAKVAIEAIRALGRRAILSRGWADLVLPDDREDCFAVDEANLQVL
FEQSAAVVHHGSAGTEHLATRAGVPQIAIPRHTDQAYYAGRVAELGVGVALEGPVPSFAA
MSAELATALAPETRARAAEVAGTVRTDGTTMAAELLFQAAEQGKLTVPA
selected fasta
>putative glycosyltransferase [glycosyltransferase]
ATGCGTGTGTTGCTGTCGACGGCGGGAAGCCGTGGAGACGTCGAACCGTTGCTGGCCTTG
GCGGTCCGGTTGCAGGGACTCGGCGCGGAGGTGCTGATGTGCGCGTCGCCTGCTTCCGCG
GAGCGGCTGGCCGAGGTCGGGGTGCCGCACGTGCCGGTCGGCCTGCAGCTGGACGGCATG
TTGTTGCAGGAAGGAATGCCGCCGCCGTCGGCCGAGGACGAGCGCAGACTCGCGGCCATG
GCGATCGACATGCAGTTCGACGCGGTCCCCGCGGCCGCCGAAGGGTGTGCCGCGGTCGTG
GCGACCGGAGAGCTGGCCGCCGCGGCCGCCGTGCGGTCGGTGGCCGAGAAGCTGGGCATC
CCGTACTTCTACGGCGCATACAGCCCGAACTACCTGGCGTCGCCGCACTATCCGCCGCCC
GACGACGAGCGGACCACCCCGGGCGTGACCGACAACGGGGTGCTGTGGGCCGAGCGTGCC
GAGCGTTTCGCCAAGCGGTACGGGGAAACGCTCAACAGCAGACGGGCGGCGATCGGCCTG
CCCCCGGTGGCGGACGTCTTCGGCTACGGCTACACCGAGCAGCCCTGGCTGGCGGCGGAC
CCGGTCCTGGCCCCGCTGGATCCGGATCTCGACGCGGTGCAGACCGGCGCGTGGATCCTG
CGTGACGATCGGCCGCTTTCCCCTGAGCTGGCGGCGTTTCTCGCTGCCGGGTCACCGCCG
GTGTACGTGGGTTTCGGCAGCGCGTCCGGGCCGGGAATCGAGGACGCCGCGAAGGTGGCC
ATCGAGGCGATCCGGGCCCTCGGCCGCCGGGCGATCCTTTCCCGCGGCTGGGCCGATCTG
GTCCTGCCCGACGACCGGGAGGACTGCTTCGCCGTCGACGAGGCGAATCTCCAGGTGCTG
TTCGAGCAGTCGGCCGCCGTCGTCCACCACGGCAGCGCGGGCACCGAGCACCTGGCCACG
CGGGCCGGCGTCCCCCAGATCGCGATACCCCGGCACACGGATCAGGCGTACTACGCCGGC
CGGGTGGCCGAGCTGGGGGTCGGTGTGGCACTCGAAGGTCCGGTCCCGTCCTTCGCGGCG
ATGTCGGCGGAGCTCGCGACGGCCCTGGCCCCGGAAACCCGTGCGCGAGCGGCGGAGGTG
GCGGGCACGGTCCGCACCGACGGGACGACGATGGCCGCGGAGCTGCTCTTCCAGGCGGCC
GAACAGGGCAAACTGACCGTTCCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-135]  1.3e-28 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit