close all open/close all

CDS information : Balhi_00180


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction44,087 / 45,313 / + [in whole cluster]
44,087 / 45,313 / + [in contig]
Location44087..45313 [in whole cluster]
44087..45313 [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-3-amino-4-keto-2,3,6-trideoxy-D-glucose C-3 C-methyltransferase
Product (GenBank)putative C-3 methyl transferase
Gene
Gene (GenBank)dvaC
EC number2.1.1.-
Keyword
  • dehydrovancosamine
Note
Note (GenBank)
Reference
ACC
PmId
[10390204] Identification and analysis of the balhimycin biosynthetic gene cluster and its use for manipulating glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908. (Antimicrob Agents Chemother. , 1999)
Related Reference
ACC
P96561
NITE
Chlor_00150
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative dTDP-3-amino-4-keto-2,3,6-trideoxy-D-glucose C-3 C-methyltransferase [putative C-3 methyl transferase]
MSTTSQCRICDGTVHEFIDFGRQPLSDAFVAPGAEKGEFFFRLATGICDSCTMVQLMEEV
PRDLMFHEAYPYLSSGSAVMRTHFHELAKHLLATELTGEDPFIVELGCNDGIMLKAVADA
GVRQLGVEPSGSVADLAAAKGIRVRKDFFEEATAADIRENDGPADVIYAANTLCHIPYMD
SILKGVTKLLGPNGVFVFEDPYLGDIVERTSFDQIYDEHFFLFTARSVQEMARRNGLELV
DVERIPVHGGEVRYTLALAGARKPSEAVAELLAWEAERKLAEYATLERFATDVKKIKEDL
IALLTKLRAEGKRVVGYGATAKSATVTNFCGITPDLVEFISDTTPAKQGKLSPGQHIPVR
EYGEFAGNHPDYALLFAWNHADEIMNVEQAFRDAGGQWILYVPNVHVS
selected fasta
>putative dTDP-3-amino-4-keto-2,3,6-trideoxy-D-glucose C-3 C-methyltransferase [putative C-3 methyl transferase]
ATGTCGACCACGTCCCAGTGCCGTATCTGTGACGGCACTGTCCACGAGTTCATCGACTTC
GGACGCCAGCCGCTCTCGGACGCGTTCGTGGCTCCCGGCGCGGAAAAGGGTGAGTTCTTC
TTCCGCCTTGCCACCGGCATCTGCGATTCCTGCACGATGGTGCAGCTGATGGAGGAAGTC
CCGCGGGACCTGATGTTCCACGAGGCCTACCCCTACCTGTCGTCGGGTTCGGCCGTCATG
CGCACGCACTTCCACGAGCTGGCCAAGCACCTGCTGGCCACGGAGCTGACCGGCGAGGAC
CCGTTCATCGTCGAGCTCGGCTGCAACGACGGCATCATGCTCAAGGCCGTGGCCGACGCG
GGGGTGCGCCAGCTCGGCGTCGAACCCTCCGGCAGTGTCGCGGATCTGGCGGCAGCCAAG
GGGATCCGCGTCCGCAAGGACTTCTTCGAAGAGGCGACGGCCGCCGACATCCGCGAGAAC
GACGGCCCCGCGGACGTGATCTACGCGGCCAACACACTGTGCCACATCCCTTACATGGAC
TCGATCCTGAAGGGCGTCACCAAGCTGCTCGGCCCGAACGGCGTGTTCGTCTTCGAGGAC
CCGTACCTCGGCGACATCGTGGAGCGCACGTCGTTCGACCAGATCTACGACGAGCATTTC
TTCCTCTTCACGGCGCGCTCGGTCCAGGAGATGGCCCGGCGCAACGGCCTCGAGCTCGTG
GACGTCGAGCGCATTCCGGTGCACGGCGGCGAGGTCCGCTACACCCTGGCCCTGGCCGGC
GCTCGCAAGCCGTCCGAGGCCGTGGCGGAGCTCCTGGCCTGGGAGGCGGAGCGCAAGCTG
GCGGAGTACGCCACGCTGGAACGTTTCGCCACCGACGTGAAGAAGATCAAGGAAGACCTG
ATCGCGCTGCTGACCAAGCTCCGTGCCGAAGGCAAGCGCGTCGTCGGCTACGGCGCGACG
GCCAAGAGTGCCACGGTGACCAACTTCTGCGGCATCACCCCGGACCTGGTCGAGTTCATC
TCGGACACGACACCGGCCAAGCAGGGCAAGCTCAGCCCGGGACAGCACATCCCGGTCCGC
GAGTACGGGGAATTCGCCGGCAACCACCCGGACTACGCCCTGCTGTTCGCCTGGAACCAC
GCCGACGAGATCATGAACGTGGAACAGGCCTTTCGTGACGCCGGCGGTCAGTGGATCCTT
TACGTGCCGAACGTGCACGTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013217 Methyltransferase type 12 (Domain)
 [104-196]  2.5e-11 PF08242
PF08242   Methyltransf_12
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [7-67]  1.1e-20 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [245-403]  1.80000000000002e-56 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit