close all open/close all

CDS information : Balhi_00190


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction45,409 / 46,233 / + [in whole cluster]
45,409 / 46,233 / + [in contig]
Location45409..46233 [in whole cluster]
45409..46233 [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF product lacks a metal binding site (histidine residue) required for deacetylase activity.
Note (GenBank)
  • orf2
Reference
ACC
PmId
[18482700] The role of cep15 in the biosynthesis of chloroeremomycin: reactivation of an ancestral catalytic function. (Chem Biol. , 2008)
Related Reference
ACC
O52804
NITE
Chlor_00160
PmId
[18482700] The role of cep15 in the biosynthesis of chloroeremomycin: reactivation of an ancestral catalytic function. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPQDLDADRILAISPHLDDAVLSFGAGLARAAQAGAKVTVHTVFAGTAAPPYSPAAERLH
AIWELSPDQDASLRRRDEDIAALDHLGVDYRHGRFLDAIYRKLPDGRWLADNVPGRQKLA
IGRQSPQGDPELFSAVRADIESIVEEYAPALILTCAAGNGHVDNEIARDAALFVAYEKGI
RVRLWEDLPHAMFAEGAAELPDGFRLGPPDFGSVEPEARARKFEALRLYSSQMLMLHGPE
KDFFAQLDGHARKSAPGGGYGETTWPVVSREDNG
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCTCAAGACCTCGACGCGGACCGGATTCTGGCGATATCCCCGCATTTGGACGACGCG
GTTCTTTCCTTCGGTGCCGGCCTCGCCCGTGCGGCGCAGGCCGGCGCGAAGGTGACCGTT
CACACGGTGTTCGCCGGGACCGCGGCGCCCCCTTATTCGCCGGCGGCGGAGCGGCTGCAC
GCGATCTGGGAGCTCTCACCGGATCAAGACGCGTCGCTCCGCCGCCGGGACGAAGACATC
GCCGCGCTCGACCACCTGGGCGTCGACTACCGGCACGGCCGGTTCCTCGACGCCATCTAC
CGCAAGCTGCCGGACGGCCGATGGCTGGCCGACAACGTGCCGGGCCGCCAGAAGCTGGCC
ATCGGACGGCAATCGCCGCAGGGCGATCCGGAGCTGTTCTCCGCGGTCCGGGCGGACATC
GAGTCGATCGTCGAAGAGTACGCCCCGGCGCTGATCCTGACCTGCGCGGCAGGCAACGGT
CATGTCGACAACGAGATCGCGCGGGATGCCGCGCTGTTCGTCGCGTACGAGAAGGGCATC
CGGGTTCGGCTGTGGGAAGACCTTCCGCACGCGATGTTCGCGGAGGGCGCCGCCGAACTG
CCGGACGGATTCCGGCTGGGGCCGCCCGATTTCGGTTCCGTCGAACCGGAGGCACGGGCG
CGGAAATTCGAAGCGCTGCGGCTCTACTCGTCGCAGATGCTGATGCTGCACGGGCCGGAA
AAGGATTTCTTCGCTCAGCTGGACGGGCATGCCCGGAAGAGTGCACCGGGTGGTGGATAC
GGCGAAACGACCTGGCCGGTTGTCTCTCGCGAAGACAACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [11-171]  9.9e-21 PF02585
PF02585   PIG-L
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [6-250]  9.19998414420354e-39 SSF102588
SSF102588   SSF102588
 [8-241]  1e-24 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   G3DSA:3.40.50.10320
SignalP No significant hit
TMHMM No significant hit