close all open/close all

CDS information : Balhi_00200


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction46,265 / 47,119 / + [in whole cluster]
46,265 / 47,119 / + [in contig]
Location46265..47119 [in whole cluster]
46265..47119 [in contig]
TypeCDS
Length855 bp (284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative SAM-dependent N-methyltransferase
Product (GenBank)putative N-methyl transferase
Gene
Gene (GenBank)bmt
EC number2.1.1.-
Keyword
  • Leu1
Note
Note (GenBank)
Reference
ACC
PmId
[12404385] The Biosynthesis of Vancomycin-Type Glycopeptide Antibiotics-The Order of the Cyclization Steps This work was supported by the Deutsche Forschungsgemeinschaft (SFB 323) and by a grant of the EU (MEGATOP, QLK3-1999-00650). R. D. S. gratefully acknowledges the support of a Feodor-Lynen Fellowship granted by the Alexander-von-Humboldt Stiftung. We thank Corina Bihlmaier and Volker Pfeifer for help with transformation and Southern hybridization, J. A. Moss (La Jolla (USA)) for critical comments on the manuscript and Prof. Dr. M. E. Maier and Prof. Dr. H.-P. Fiedler (Tubingen) for generous support. (Angew Chem Int Ed Engl. , 2001)
[12596194] Vancomycin assembly: nature's way. (Angew Chem Int Ed Engl. , 2003)
Related Reference
ACC
O52805
NITE
Chlor_00170
PmId
[19389626] Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. (Chem Biol. , 2009)
ACC
R4T056
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative SAM-dependent N-methyltransferase [putative N-methyl transferase]
MSGQLERGPVRTTHADVLLASVGERGVLCDFYDEEGSNTYRDLIQDADGTPEAREFATRV
GPVPGPVLELAAGTGRLTFPFLELGWEVTALELSAPVVDGFRMRLAEAPADLRDRCTVVQ
ADMSAFSVDRRFGAAVISSGSVNELDEAGRQGLYASVREHLEPGGKFLLSLALSEVAESQ
PPERRQELPGQSGRLYVLHVSVQPAEETQDITIYPADETADPFVVCTHRRRLVPADRIVR
ELLRAGFDVIARTPFASGASGRAGHEDMLLVEAVKQEGAIPAAR
selected fasta
>putative SAM-dependent N-methyltransferase [putative N-methyl transferase]
GTGAGCGGTCAACTCGAGCGTGGTCCGGTGCGGACCACGCACGCCGACGTCCTGCTGGCC
TCGGTGGGTGAGCGAGGCGTTCTGTGCGACTTCTACGACGAGGAGGGCTCGAACACCTAT
CGGGACCTGATCCAGGACGCGGACGGTACCCCGGAAGCGCGGGAGTTCGCCACTCGCGTC
GGCCCGGTGCCCGGACCCGTGCTGGAGCTCGCGGCCGGCACGGGCCGGCTGACCTTCCCG
TTCCTGGAGCTCGGCTGGGAGGTGACCGCCCTGGAACTGTCGGCCCCGGTGGTCGACGGC
TTCCGGATGCGGCTGGCGGAAGCACCGGCGGACCTGCGGGACCGCTGCACAGTGGTTCAG
GCGGACATGAGCGCTTTCTCGGTGGACCGGCGCTTCGGGGCAGCGGTCATCAGCTCGGGT
TCGGTCAACGAACTGGACGAAGCCGGCCGGCAGGGCCTGTACGCGTCGGTTCGCGAGCAC
CTCGAGCCCGGCGGGAAGTTCCTGCTCAGCCTGGCCTTGTCGGAGGTCGCCGAGTCACAG
CCGCCGGAGCGCCGGCAAGAGTTGCCAGGCCAGAGCGGCCGGCTGTACGTGTTGCACGTG
AGTGTGCAGCCGGCGGAGGAGACCCAGGACATCACGATCTACCCCGCCGACGAAACAGCG
GATCCCTTCGTCGTCTGCACGCATCGCCGCCGGCTCGTCCCGGCGGACCGGATAGTGCGG
GAACTTCTTCGGGCCGGCTTCGACGTGATCGCGCGGACGCCGTTCGCGTCCGGTGCGTCC
GGCCGGGCGGGCCATGAAGACATGTTGCTGGTGGAAGCGGTGAAGCAGGAGGGCGCTATC
CCAGCCGCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit