close all open/close all

CDS information : Balhi_00210


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction48,404 / 47,100 / - [in whole cluster]
48,404 / 47,100 / - [in contig]
Locationcomplement(47100..48404) [in whole cluster]
complement(47100..48404) [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productaminotransferase
Product (GenBank)phenylglycine amino transferase
Gene
Gene (GenBank)pgat
EC number2.6.1.-
Keyword
  • Dpg
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
Related Reference
ACC
O52815
NITE
Chlor_00180
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>aminotransferase [phenylglycine amino transferase]
MEILVFMDSFGLSTPLSVETLHGSLTDPAISSMNLLNELIDEYPVAISMAAGRPYEEFFD
IRLIHEYIDAYCDHLRRDRKLDEAGVTRTLFQYGTTKGVIADLIARNLAEDENIDAAPES
VVVTVGAQEAMFLVLRTLRATEHDVLLAPAPTYVGLTGAALLTDTPVWPVQSTENGIDPD
DLVLQLKRADEQGKRVRACYVTPNFANPTGTSMDLAARHRLLEVAEANGILLLEDNAYGL
FGAERLPTLKALDRSGTVVYIGSFAKTGMPGARVGFTVADQRMAGGGLLADQLSKLKGML
TVNTSPIAQSVIAGKLLLNDFSLTKANAREIAVYQRNLRLVLGELERRLGGRAGVRWNTP
TGGFFVTVTVPFTVDDDLLALAARDHGVLFTPMHHFYGGKGGFNQLRLSISLLTPELIEE
GVARLAALITARLG
selected fasta
>aminotransferase [phenylglycine amino transferase]
ATGGAAATCCTAGTATTTATGGATTCCTTCGGTCTGTCCACCCCATTGAGCGTGGAAACC
CTGCACGGATCGCTCACCGATCCGGCCATCTCGTCGATGAACTTGCTCAACGAGCTGATC
GACGAATACCCGGTGGCTATTTCCATGGCGGCAGGCCGCCCGTACGAAGAATTCTTCGAC
ATCCGCCTCATCCACGAGTACATCGACGCCTACTGCGACCACCTCCGCCGCGACCGGAAG
CTCGACGAAGCGGGGGTCACCCGCACGCTCTTCCAGTACGGCACCACGAAAGGCGTCATC
GCCGACCTCATCGCCCGCAACCTCGCCGAGGACGAGAACATCGACGCCGCCCCGGAATCC
GTGGTGGTCACCGTGGGCGCCCAGGAGGCGATGTTCCTGGTGCTTCGCACGCTGCGGGCG
ACCGAACACGACGTGCTGCTCGCCCCCGCCCCCACCTACGTCGGCCTGACGGGGGCGGCG
CTGCTCACCGACACGCCCGTCTGGCCGGTGCAGTCGACCGAGAACGGCATCGACCCGGAC
GACCTGGTCCTGCAGCTGAAGCGGGCCGACGAACAGGGCAAGCGGGTCCGGGCCTGTTAC
GTGACACCGAACTTCGCCAACCCGACCGGGACCAGCATGGACCTGGCCGCCCGGCACCGG
CTCCTCGAGGTCGCCGAGGCCAACGGCATCCTGCTCCTGGAGGACAACGCGTACGGGCTC
TTCGGCGCCGAACGCCTCCCCACCCTGAAAGCCCTCGACCGGTCGGGGACCGTGGTCTAC
ATCGGCTCCTTCGCCAAGACCGGCATGCCCGGTGCCCGGGTCGGCTTCACCGTGGCGGAC
CAGCGAATGGCCGGGGGCGGCCTGCTCGCCGACCAGCTCTCCAAGCTCAAGGGCATGCTC
ACGGTGAACACGTCCCCGATAGCCCAGTCGGTGATCGCCGGGAAGCTGCTCCTCAACGAC
TTCAGCCTGACCAAGGCCAACGCGCGCGAGATCGCGGTCTACCAGCGCAACCTGCGGCTC
GTGCTGGGCGAGCTCGAGCGACGGCTCGGCGGGCGCGCCGGGGTCCGCTGGAACACGCCG
ACCGGTGGGTTCTTCGTCACCGTCACCGTCCCCTTCACCGTCGACGACGACCTGCTCGCC
CTCGCCGCCCGCGACCACGGCGTGCTGTTCACCCCGATGCACCACTTCTACGGCGGCAAG
GGCGGGTTCAACCAGCTGCGGCTGTCGATCAGCCTGCTCACCCCGGAACTGATCGAAGAG
GGCGTCGCCCGGCTCGCCGCGCTCATCACCGCGCGGCTGGGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [84-425]  3.39999999999999e-30 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [85-305]  3.80000000000003e-41 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [306-429]  9.39999999999999e-07 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [7-429]  6.40004254961849e-72 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit