close all open/close all

CDS information : Balhi_00220


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction48,610 / 49,464 / + [in whole cluster]
48,610 / 49,464 / + [in contig]
Location48610..49464 [in whole cluster]
48610..49464 [in contig]
TypeCDS
Length855 bp (284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productthioesterase
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)bhp
EC number
Keyword
  • Bht
  • unusual type
Note
Note (GenBank)
Reference
ACC
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[19998400] The thioesterase Bhp is involved in the formation of beta-hydroxytyrosine during balhimycin biosynthesis in Amycolatopsis balhimycina. (Chembiochem. , 2010)

close this sectionSequence

selected fasta
>thioesterase [putative hydrolase]
MLMTTEHGIRLSYHDQGRGAPVLLLTGTGAPSSVWDLHQVPALRAAGFRVITMDNRGIPP
SDDGADGFTVDDLVADVAALLDHLDASPCRVVGTSMGSYIAQELALARPELVDAVVLMAA
CGRSSLVQRVLAEAEADLIGRGTELPPGYRAAVRAMHNLGPATLADDDLAADWLDLFAAS
ENWGPGVRAQLLLSALPDRREAYRAIKVPCHVVSFEHDLVAPPSAGQELAAVIPGATHRT
IPGCGHFGYLEKPEAVNRELLRFLRTESGVAVTSGASPRTPEEL
selected fasta
>thioesterase [putative hydrolase]
ATGCTGATGACGACTGAGCACGGGATCCGGCTGTCGTACCACGACCAGGGCCGTGGTGCG
CCGGTTCTGCTGCTGACCGGCACCGGGGCGCCGAGCTCGGTGTGGGACCTGCACCAGGTG
CCCGCGCTCCGCGCCGCCGGGTTCCGGGTGATCACCATGGACAACCGCGGGATCCCGCCC
AGCGACGACGGCGCGGACGGGTTCACCGTCGACGACCTCGTCGCGGACGTGGCCGCGCTG
CTCGACCACCTCGACGCGTCGCCGTGCCGCGTCGTCGGCACGTCGATGGGCTCGTACATC
GCGCAGGAGCTGGCGCTGGCCCGCCCGGAACTGGTGGACGCCGTCGTGCTGATGGCGGCC
TGCGGCCGGAGCAGTCTCGTCCAGCGCGTGCTCGCGGAGGCCGAGGCGGACCTGATCGGA
CGGGGGACCGAGCTGCCGCCGGGGTACCGCGCCGCCGTTCGCGCGATGCACAACCTGGGG
CCCGCGACGCTCGCCGACGACGACCTCGCTGCCGACTGGCTCGACCTGTTCGCGGCGTCG
GAGAACTGGGGGCCGGGCGTCCGGGCGCAGCTGCTGCTGAGCGCGTTGCCCGACCGTCGC
GAGGCCTACCGGGCGATCAAGGTGCCCTGCCACGTCGTTTCGTTCGAGCACGACCTCGTG
GCGCCGCCGTCCGCCGGGCAGGAGCTGGCCGCCGTGATCCCCGGCGCCACGCACCGCACG
ATCCCGGGGTGCGGGCACTTCGGCTACCTGGAGAAGCCGGAAGCGGTGAACCGCGAGCTG
CTCCGGTTCCTCCGCACGGAATCCGGCGTGGCTGTGACATCCGGGGCTTCGCCCCGGACC
CCCGAAGAACTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [47-62]  4.79999776836274e-06 PR00111 [91-104]  4.79999776836274e-06 PR00111 [105-118]  4.79999776836274e-06 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [47-62]  3.39999972437717e-08 PR00412 [208-224]  3.39999972437717e-08 PR00412 [241-263]  3.39999972437717e-08 PR00412
PR00412   EPOXHYDRLASE
SignalP No significant hit
TMHMM No significant hit