close all open/close all

CDS information : Balhi_00230


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction49,530 / 51,275 / + [in whole cluster]
49,530 / 51,275 / + [in contig]
Location49530..51275 [in whole cluster]
49530..51275 [in contig]
TypeCDS
Length1,746 bp (581 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
ProductL-tyrosine--PCP ligase/peptidyl carrier protein
L-tyrosyl-PCP synthetase/peptidyl carrier protein
Product (GenBank)peptide synthetase
Gene
Gene (GenBank)bpsD
EC number
Keyword
  • Bht
Note
Note (GenBank)
Reference
ACC
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[20519494] Structural characterization of OxyD, a cytochrome P450 involved in beta-hydroxytyrosine formation in vancomycin biosynthesis. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

B1 tyrosine
A36..429
PCP510..577

close this sectionSequence

selected fasta
>L-tyrosine--PCP ligase/peptidyl carrier protein [peptide synthetase]
MTGAIVPPSTAPALFEAAAAAVPDRPAVAMGTTTLTYAELNTQANRLARRLVAHGVGPER
LVALAMPRSIEFAVAMLAVHKAGGAYVPIDPDYPAERRQHMLAGAAAQCLLCLPGQDVAG
APVVLSVALAEPGRPEPDLDDSDRLAPLLPSHPAYVIFTSGSTGQPKGVVVTHRGIPNLA
ADYVHRQNLLPDSRLLAFASPSFDAAVAEFWPIWLAGACLVLAPAPDLIPGEPLARLVRD
RHITHVTLPPSALAPLEEAGGLPPGLTLLVAGEAGPAPVAKRWAAGRVMINAYGPTEATV
AVTASDPLTGEDTPPIGRPITGVHTYVLDDRLVPVPDGTVGELYMTGPGLARGYLHRPAA
TAERFLPDPFGGPGQRMYRTGDRVRARPDGQLVFVGRADDQLKVRGHRIEPAEVESALLA
VDGVAQAVVTEHDNRLVAYVVGAGGARVPAEDLLPPLRKQLPAYLVPDVVVGLPHLPTTP
NGKVDRAALPAPEAEDTGRAISGRAPSTPTEIHLAALFAEVLGVSSVGVEDSFFEVGGHS
LLATRLVSRIRESLRVRLRVQAFFDAPTVAELAKVLDAALT
selected fasta
>L-tyrosine--PCP ligase/peptidyl carrier protein [peptide synthetase]
ATGACCGGCGCGATCGTGCCCCCGTCCACGGCACCCGCCCTGTTCGAGGCGGCCGCCGCC
GCGGTGCCGGACCGGCCGGCCGTGGCGATGGGGACCACCACGCTGACCTACGCCGAGCTG
AATACCCAGGCCAACCGGCTCGCGCGCCGGCTCGTGGCGCACGGCGTGGGCCCGGAACGG
CTGGTCGCACTGGCGATGCCGCGGTCGATCGAGTTCGCCGTCGCGATGCTGGCCGTGCAC
AAGGCCGGCGGTGCGTACGTGCCGATCGACCCGGACTATCCCGCGGAACGCCGGCAGCAC
ATGCTGGCCGGTGCGGCGGCGCAGTGCCTGCTGTGCCTGCCCGGGCAGGACGTCGCCGGC
GCTCCGGTCGTGCTGAGCGTGGCGCTGGCGGAGCCGGGCCGTCCCGAGCCGGACCTGGAC
GACTCCGACCGGCTCGCCCCGCTGCTGCCCAGCCACCCCGCGTACGTCATCTTCACCTCG
GGCTCGACCGGGCAGCCGAAGGGCGTCGTGGTCACGCACCGGGGAATCCCGAACCTGGCC
GCCGACTACGTGCACCGCCAGAACCTGCTGCCCGACAGCCGGTTGCTGGCTTTCGCGTCC
CCCAGCTTCGACGCCGCCGTCGCCGAGTTCTGGCCGATCTGGCTGGCCGGTGCCTGCCTG
GTGCTGGCGCCCGCGCCGGACCTGATCCCCGGGGAGCCGCTCGCCCGGCTGGTCCGGGAC
CGGCACATCACCCACGTGACGCTGCCGCCGTCCGCCCTGGCCCCGCTGGAAGAAGCCGGC
GGCCTGCCGCCGGGGCTGACCCTCCTGGTCGCCGGCGAGGCGGGCCCGGCTCCGGTCGCG
AAGCGCTGGGCCGCCGGCCGCGTCATGATCAACGCGTACGGCCCCACCGAAGCCACGGTC
GCGGTGACCGCGAGCGACCCGCTGACCGGCGAAGACACGCCGCCGATCGGCAGGCCGATC
ACCGGTGTCCACACCTACGTCCTGGACGACCGGCTGGTCCCCGTCCCGGACGGGACCGTG
GGGGAGCTGTACATGACCGGCCCGGGCCTCGCCCGCGGTTACCTGCACCGGCCGGCCGCG
ACCGCGGAACGGTTCCTGCCGGACCCGTTCGGCGGTCCGGGGCAGCGCATGTACCGCACG
GGTGACCGGGTGCGGGCGCGCCCGGACGGTCAGCTCGTCTTCGTCGGCCGGGCCGACGAC
CAGCTGAAGGTGCGTGGTCACCGGATCGAGCCGGCGGAGGTCGAATCCGCGCTGCTCGCG
GTGGACGGGGTGGCCCAGGCGGTGGTGACCGAACACGACAACCGGCTCGTGGCGTACGTG
GTCGGCGCCGGGGGCGCGCGGGTGCCCGCCGAAGACCTCCTGCCGCCGCTGAGGAAGCAG
CTGCCCGCCTACCTGGTCCCCGACGTGGTCGTCGGCCTGCCGCACCTGCCGACCACCCCG
AACGGCAAGGTCGACCGGGCCGCGCTGCCCGCGCCCGAGGCGGAGGACACCGGGCGCGCG
ATCTCCGGGCGGGCGCCGAGCACGCCCACGGAAATCCACCTGGCCGCCTTGTTCGCGGAA
GTGCTCGGTGTCAGCAGCGTCGGCGTGGAGGACAGCTTCTTCGAGGTCGGCGGCCACTCG
CTGCTCGCCACCCGGCTGGTTTCCCGCATCCGCGAAAGCCTGCGGGTCCGGCTGCGGGTG
CAGGCCTTCTTCGACGCGCCGACCGTGGCCGAACTCGCCAAGGTGCTCGACGCCGCCCTG
ACGTGA
[1] A36..429
[1] tyrosine204..301
[1] PCP510..577
[1] A106..1287
[1] tyrosine610..903
[1] PCP1528..1731

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-429]  1.60000000000002e-110 PF00501
PF00501   AMP-binding
IPR006162 Phosphopantetheine attachment site (PTM)
 [535-550]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [502-579]  8.30000000000004e-28 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [503-578]  2.10000267834031e-20 SSF47336
SSF47336   ACP_like
 [510-577]  PS50075
PS50075   ACP_DOMAIN
 [514-574]  4.80000000000001e-13 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [36-429]  2.70000000000008e-129 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [156-167]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit