close all open/close all

CDS information : Balhi_00250


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction52,645 / 53,715 / + [in whole cluster]
52,645 / 53,715 / + [in contig]
Location52645..53715 [in whole cluster]
52645..53715 [in contig]
TypeCDS
Length1,071 bp (356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate synthase
Product (GenBank)putative hydroxyphenyl pyruvate dioxygenase
Gene
Gene (GenBank)hmaS
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52791
NITE
Chlor_00220
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate synthase [putative hydroxyphenyl pyruvate dioxygenase]
MTSDSTVQNFEIDYVEMYVENLEAATFTWVDKYAFAVAGTDRSADHRSVTLRQGPIKLVL
TEPTSDRHPAAAYLQSHGDGVADIALRTPDVTAAFEAAVRGGAAAVREPVRLAGGPIVTA
TIGGFGDVVHTLIQSGEATAAAPETTGQGGGDVNLLGLDHFAVCLNSGDLGPTVAFYERA
FGFRQIFEEHIVVGRQAMNSTVVQSASGEVTLTLIEPDSNADPGQIDEFLKAHQGAGVQH
IAFNADDAVRAVRALSGRGVEFLKTPGTYYDMLGERITLETHTLDDLRSTNVLADEDHGG
QLFQIFAASTHPRHTIFFEIIERQGAGTFGSSNIKALYEAVELERTGQSEFGAARR
selected fasta
>putative 4-hydroxymandelate synthase [putative hydroxyphenyl pyruvate dioxygenase]
TTGACTTCCGATTCGACTGTCCAGAATTTCGAGATCGACTACGTCGAAATGTATGTGGAA
AACCTCGAGGCGGCCACGTTCACCTGGGTCGACAAGTATGCTTTCGCCGTCGCCGGTACC
GACCGGTCGGCGGACCACCGGAGCGTCACGCTGCGGCAGGGCCCGATCAAGCTGGTCCTC
ACCGAACCGACGTCGGACCGGCACCCGGCGGCCGCCTACCTCCAGTCGCACGGCGACGGC
GTGGCCGACATCGCGCTGCGCACGCCGGACGTGACCGCCGCTTTCGAAGCCGCGGTGCGG
GGCGGGGCCGCCGCCGTGCGCGAACCGGTGCGGCTCGCCGGCGGGCCGATCGTCACGGCC
ACCATCGGCGGGTTCGGCGACGTCGTGCACACCCTGATCCAGAGCGGCGAAGCCACCGCG
GCCGCGCCGGAGACCACCGGCCAGGGCGGGGGAGACGTGAACCTGCTCGGGCTCGACCAC
TTCGCGGTCTGCCTGAACTCGGGTGACCTCGGTCCCACGGTGGCGTTCTACGAGCGGGCC
TTCGGGTTCCGGCAGATCTTCGAGGAGCACATCGTGGTCGGCAGGCAGGCGATGAACTCC
ACCGTGGTGCAGAGCGCGTCGGGGGAGGTCACCCTCACCCTGATCGAGCCCGACAGCAAC
GCCGACCCCGGCCAGATCGACGAGTTCCTCAAGGCCCACCAGGGAGCCGGCGTCCAGCAC
ATCGCCTTCAACGCCGACGACGCGGTCCGCGCGGTCCGGGCGCTGTCCGGCCGCGGGGTG
GAGTTCCTGAAGACTCCGGGGACCTATTACGACATGCTCGGCGAGCGGATCACGCTGGAG
ACGCACACGCTGGACGACCTGCGGTCGACGAACGTGCTCGCCGACGAGGACCACGGCGGC
CAGCTGTTCCAGATCTTCGCCGCTTCCACCCACCCGCGTCACACCATCTTCTTCGAGATC
ATCGAGCGGCAGGGCGCGGGAACCTTCGGCAGCTCCAACATCAAGGCCCTGTACGAGGCC
GTGGAGCTGGAGCGGACCGGGCAGAGCGAGTTCGGCGCCGCCCGGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [157-305]  2.2e-19 PF00903
PF00903   Glyoxalase
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [11-349]  1.10000000000001e-112 TIGR01263
TIGR01263   4HPPD
 [1-350]  PIRSF009283
PIRSF009283   HPP_dOase
SignalP No significant hit
TMHMM No significant hit