close all open/close all

CDS information : Balhi_00260


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction53,712 / 54,788 / + [in whole cluster]
53,712 / 54,788 / + [in contig]
Location53712..54788 [in whole cluster]
53712..54788 [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate oxidase
Product (GenBank)putative phenylglycolate oxidase
Gene
Gene (GenBank)hmo
EC number1.1.3.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52792
NITE
Chlor_00230
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[12240298] Characterisation of a hydroxymandelate oxidase involved in the biosynthesis of two unusual amino acids occurring in the vancomycin group of antibiotics. (Chem Commun (Camb). , 2001)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate oxidase [putative phenylglycolate oxidase]
MTYVSLGDLERAARDVLPGEIWDFLAGGSGAEASLTANRTALDRVFVVPRMLCDLTGSTT
EAELLGRRAALPMAVAPVAYQRLFHPEGELAAARAARDAGVPYTICTLSSVPLEEVAAVG
GRPWFQLYWLRDEKRSLELVRRAEDAGCEAIVFTVDVPWMGRRWRDMRNGFALPESVTAA
NFDAGSAAHRRTRGASAVADHTAREFAPATWESVATVRAHTDLPVVLKGILAAEDARRAV
EAGADGIVVSNHGGRQLDGAVPGIEVLGEIAAEVSGRCEVLLDGGIRTGGDILKAAALGA
SGVLVGRPVMWGLAAAGQEGVRQVFELLAAELRNALGLAGCDSVSAAGRLGTRVPRYG
selected fasta
>putative 4-hydroxymandelate oxidase [putative phenylglycolate oxidase]
ATGACGTACGTTTCCCTGGGCGACCTCGAACGTGCCGCTCGCGACGTCCTCCCCGGCGAG
ATCTGGGACTTCCTCGCCGGGGGGAGCGGCGCCGAGGCATCGCTGACGGCCAACCGCACC
GCGCTCGACCGGGTTTTCGTGGTTCCCCGGATGCTGTGCGACCTGACCGGCAGCACCACC
GAGGCCGAGCTCCTGGGCCGGCGCGCCGCGCTCCCGATGGCGGTCGCGCCGGTCGCGTAC
CAGCGGTTGTTCCACCCCGAGGGCGAGCTGGCGGCCGCTCGCGCGGCTCGCGACGCCGGC
GTGCCGTACACCATCTGCACCTTGAGCAGCGTCCCGCTCGAGGAGGTCGCGGCCGTCGGC
GGCCGGCCGTGGTTCCAGCTGTACTGGCTGCGTGACGAGAAGCGGTCGCTGGAGCTCGTG
CGCCGCGCGGAAGACGCCGGGTGCGAAGCGATCGTGTTCACCGTGGACGTGCCGTGGATG
GGACGGCGGTGGCGGGACATGCGCAACGGCTTCGCGTTGCCGGAATCGGTGACAGCGGCC
AACTTCGACGCCGGATCGGCCGCGCACCGCCGCACGCGCGGGGCCTCGGCCGTGGCCGAC
CACACCGCGCGCGAGTTCGCCCCCGCCACCTGGGAGTCGGTGGCGACGGTCCGCGCGCAC
ACGGACCTGCCGGTGGTGCTCAAGGGCATCCTCGCCGCCGAGGACGCCCGCCGTGCCGTC
GAGGCCGGGGCCGACGGGATCGTGGTGTCCAACCACGGAGGTCGTCAGTTGGACGGCGCG
GTGCCCGGGATCGAGGTGCTGGGCGAGATCGCCGCCGAGGTCTCCGGCCGCTGCGAAGTG
CTGCTGGACGGCGGAATCCGGACCGGCGGGGACATCCTCAAGGCGGCCGCGCTGGGCGCG
TCGGGCGTGCTGGTCGGGCGGCCCGTGATGTGGGGGCTGGCCGCGGCGGGCCAGGAGGGC
GTCCGGCAGGTGTTCGAACTGCTCGCCGCCGAACTCCGGAACGCGCTGGGCCTGGCGGGC
TGTGACTCGGTGAGCGCGGCCGGCCGGCTGGGCACGAGGGTCCCCCGCTACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000262 FMN-dependent dehydrogenase (Domain)
 [13-347]  2.09999999999996e-122 PF01070
PF01070   FMN_dh
IPR008259 FMN-dependent alpha-hydroxy acid dehydrogenase, active site (Active_site)
 [250-256]  PS00557
PS00557   FMN_HYDROXY_ACID_DH_1
IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent (Family)
 [1-356]  PIRSF000138
PIRSF000138   Al-hdrx_acd_dh
 [1-357]  PS51349
PS51349   FMN_HYDROXY_ACID_DH_2
IPR013785 Aldolase-type TIM barrel (Domain)
 [3-348]  6.29999999999998e-128 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit