close all open/close all

CDS information : Balhi_00270


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction54,879 / 56,237 / + [in whole cluster]
54,879 / 56,237 / + [in contig]
Location54879..56237 [in whole cluster]
54879..56237 [in contig]
TypeCDS
Length1,359 bp (452 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transporter
Product (GenBank)putative antiporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in balhimycin biosynthesis and resistance.
Note (GenBank)
  • orf7
Reference
ACC
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [putative antiporter]
MLHTFAAAVAPVAPIAAHSLLVFLLQIGLLLLLAVVLGRLAGRFGMPAVVGELFVGVILG
PSLLGWAAPGLHSWLFPAVAEQYHLLDAVGQVGVLLLVGLTGVQMDMGLARKRGLTAAGV
SIGGLVLPLGLGIGAGYLLPKVLVPEGTDVTVFAMFLGVALCVSAIPVIAKTLIDMKLLH
RNIGQLTLTAGMVDDVFGWFMLSVVSAMAVNAVSAGTVLTSLAYLVAILAFCFTLGRPLA
RGVLRVAAKSDGPGLTVATVVVLIFLAAAGTQALGLEAVFGAFLCGILLGTAGKVDPAKL
APLRTVVLSGLAPLFFATAGLRMDLTALTHPVVLLTGLVVLALAIAGKFAGAFAGARLSG
LNKWEGLALGAGLNARGVIQVVVAMVGLRLGILSVEVYTIIILVAIVTSLMASPILRFAM
SRVEQTAEEQVRENEHRAWNTHPAANPQEQSL
selected fasta
>putative transporter [putative antiporter]
ATGCTGCACACCTTTGCCGCGGCGGTCGCGCCGGTCGCACCGATCGCCGCGCACAGTCTC
CTGGTCTTCCTGCTGCAGATCGGCTTGCTGCTCCTGCTCGCCGTCGTGCTCGGCCGGCTG
GCCGGCCGGTTCGGGATGCCCGCGGTCGTCGGTGAGCTGTTCGTCGGGGTGATCCTCGGT
CCGTCGCTGCTGGGCTGGGCGGCGCCGGGCCTGCACAGCTGGCTGTTCCCGGCCGTCGCC
GAGCAGTACCACCTGCTCGACGCCGTCGGCCAGGTCGGCGTCCTGCTGCTGGTCGGCCTC
ACCGGCGTGCAGATGGACATGGGGCTGGCCCGCAAGCGCGGCCTCACCGCGGCCGGGGTC
AGCATCGGCGGCCTGGTCCTTCCGCTCGGCCTGGGGATCGGCGCGGGTTACCTGCTGCCG
AAGGTGCTCGTTCCGGAGGGCACCGACGTCACCGTCTTCGCGATGTTCCTCGGCGTGGCC
CTGTGCGTCAGCGCCATCCCGGTCATCGCCAAGACCCTCATCGACATGAAACTGCTGCAC
CGCAACATCGGGCAGCTCACGCTCACCGCCGGCATGGTCGACGACGTGTTCGGCTGGTTC
ATGCTGTCCGTCGTCAGCGCGATGGCGGTCAACGCGGTCTCCGCCGGCACCGTGCTCACT
TCGCTGGCCTACCTGGTCGCCATCCTCGCCTTCTGTTTCACCCTCGGCCGTCCGCTGGCC
CGGGGTGTGCTCCGCGTCGCGGCCAAGTCCGACGGTCCCGGGCTCACCGTCGCCACCGTC
GTCGTCCTGATCTTCCTCGCCGCGGCCGGTACGCAGGCGCTCGGCCTGGAGGCGGTCTTC
GGCGCCTTCCTCTGCGGCATCCTGCTCGGGACGGCGGGCAAGGTGGATCCGGCCAAGCTC
GCCCCCCTGCGCACGGTCGTCCTGTCGGGACTCGCCCCCCTCTTCTTCGCCACGGCCGGG
TTGCGGATGGACCTCACCGCGCTGACCCACCCGGTGGTCCTGCTCACCGGTCTGGTGGTG
CTCGCCCTGGCCATCGCCGGCAAGTTCGCCGGCGCGTTCGCCGGCGCGCGGCTGAGCGGG
TTGAACAAGTGGGAAGGGCTGGCGCTCGGCGCCGGGCTGAACGCGCGGGGAGTCATCCAG
GTCGTGGTGGCCATGGTCGGCCTGCGGCTGGGTATCCTCAGCGTGGAGGTCTACACGATC
ATCATCCTCGTCGCGATCGTCACTTCCCTGATGGCGTCGCCGATCCTGCGGTTCGCGATG
TCCAGAGTGGAGCAGACCGCCGAAGAACAGGTTCGCGAGAACGAACACCGGGCGTGGAAC
ACGCACCCGGCGGCGAACCCGCAGGAGCAAAGTCTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [29-418]  1.09999999999999e-49 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [15-37]  Transmembrane (o-i) [49-68]  Transmembrane (i-o) [83-102]  Transmembrane (o-i) [115-137]  Transmembrane (i-o) [152-174]  Transmembrane (o-i) [186-208]  Transmembrane (i-o) [218-240]  Transmembrane (o-i) [252-269]  Transmembrane (i-o) [274-293]  Transmembrane (o-i) [300-322]  Transmembrane (i-o) [332-354]  Transmembrane (o-i) [366-388]  Transmembrane (i-o) [398-420]  Transmembrane (o-i)
Transmembrane 13