close all open/close all

CDS information : Balhi_00290


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction57,915 / 58,214 / + [in whole cluster]
57,915 / 58,214 / + [in contig]
Location57915..58214 [in whole cluster]
57915..58214 [in contig]
TypeCDS
Length300 bp (99 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative 4-ketoreductase
Gene
Gene (GenBank)dvaE
EC number
Keyword
Note
Note (GenBank)
  • probably not active because of an in frame deletion of 226 aa
Reference
ACC
PmId
[19374994] Chapter 18. Molecular genetic approaches to analyze glycopeptide biosynthesis. (Methods Enzymol. , 2009)
Related Reference
ACC
O52794
NITE
Chlor_00250
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [putative 4-ketoreductase]
MKTVTVLGASGFAGSAVHRLGEVFRLVAREVAGHTGRGPVDVPCVAPPSHAPETDFRSVT
VGSTPFRSITGRRPEMSRPEGVRRTVAALPSSDQGKVRT
selected fasta
>hypothetical protein [putative 4-ketoreductase]
ATGAAGACGGTCACCGTCCTCGGCGCCTCGGGTTTCGCCGGCTCGGCCGTCCACCGGCTG
GGCGAAGTCTTCCGGCTCGTGGCACGGGAGGTCGCCGGGCACACCGGACGCGGCCCGGTG
GACGTGCCCTGCGTGGCACCCCCGTCGCACGCGCCCGAGACGGATTTCCGGAGCGTCACG
GTCGGTTCCACGCCGTTCCGGTCGATCACCGGCCGGCGCCCGGAGATGTCGCGGCCCGAG
GGAGTGCGCCGCACTGTCGCCGCTTTGCCGTCATCAGATCAGGGAAAGGTTCGCACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit