close all open/close all

CDS information : Balhi_00300


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction58,211 / 59,320 / + [in whole cluster]
58,211 / 59,320 / + [in contig]
Location58211..59320 [in whole cluster]
58211..59320 [in contig]
TypeCDS
Length1,110 bp (369 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-hexose C-3 aminotransferase
Product (GenBank)putative C-3 amino transferase
Gene
Gene (GenBank)dvaB
EC number2.6.1.-
Keyword
  • dehydrovancosamine
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52807
NITE
Chlor_00260
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative dTDP-hexose C-3 aminotransferase [putative C-3 amino transferase]
MTTRVWDYQAEYRNERLDLLDAVETVFDSGQLVLGASVRGFEAEFAAYHGVGHCVGLDNG
TNAIKLGLQALGVGPGDEVITVSNTAAPTVVAIDGTGATPVFVDVREDDFLMDTGQVAAA
ITERTKCLLPVHLYGQCVDMAPLKDLAAKHGLSILEDCAQAHGARQNGTVAGSTGDAAAF
SFYPTKVLGAYGDGGATITSDESVDRRLRRLRYYGMDKQYYTLETPAHNSRLDEVQAEIL
RRKLKRLDTYVAARQAIAQRYVDGLGDTELKLPRTVPGNEHVYYVYVVRHPRRDDIIERL
KAYDIHLNISYPWPVHTMTGFAHLGYATGAFPVTEKLAGEIFSLPMYPALSADLQDKVIH
AVREVVSTL
selected fasta
>putative dTDP-hexose C-3 aminotransferase [putative C-3 amino transferase]
ATGACCACGCGTGTATGGGACTACCAGGCCGAATACCGGAACGAGCGGCTCGACCTGCTG
GACGCGGTCGAGACGGTCTTCGACTCGGGGCAGCTCGTGCTCGGGGCGAGCGTGCGTGGC
TTCGAGGCGGAATTCGCCGCGTACCACGGGGTCGGGCACTGCGTTGGCCTCGACAACGGG
ACGAACGCGATCAAGCTCGGCCTGCAGGCGCTGGGTGTCGGGCCGGGCGACGAGGTGATC
ACGGTGTCCAACACCGCCGCCCCGACCGTGGTCGCCATCGACGGCACCGGCGCCACGCCG
GTCTTCGTCGACGTCCGCGAGGACGACTTCCTGATGGACACCGGCCAGGTCGCGGCCGCG
ATCACCGAGCGCACCAAGTGCCTGCTGCCCGTGCACCTATACGGACAGTGCGTGGACATG
GCTCCGCTGAAGGACCTCGCCGCGAAGCATGGACTGTCCATTTTGGAGGACTGTGCCCAG
GCGCACGGGGCCCGGCAGAACGGAACGGTCGCGGGCTCGACCGGTGACGCGGCCGCGTTC
TCCTTCTACCCGACCAAGGTGCTCGGGGCGTACGGCGACGGCGGCGCGACCATCACCTCC
GACGAATCCGTGGACCGGCGGCTGCGGCGGCTGCGCTACTACGGCATGGACAAGCAGTAC
TACACGCTGGAAACGCCGGCCCACAACAGCCGGCTGGACGAGGTCCAGGCCGAGATCCTG
CGGCGCAAGCTCAAGCGGCTCGACACCTACGTCGCCGCCCGCCAGGCCATCGCCCAGCGC
TACGTCGACGGACTGGGCGACACGGAGCTGAAGCTGCCGCGGACCGTCCCCGGCAACGAG
CACGTGTACTACGTGTACGTCGTGCGCCACCCGCGACGTGACGACATCATCGAGCGCCTC
AAGGCGTACGACATCCACTTGAACATCAGCTATCCGTGGCCGGTGCACACCATGACCGGT
TTCGCCCACCTCGGCTACGCGACCGGCGCGTTCCCGGTCACCGAAAAACTGGCCGGCGAG
ATCTTCTCGCTGCCGATGTACCCCGCGCTTTCCGCCGACCTGCAGGACAAGGTCATCCAT
GCGGTGCGCGAGGTGGTGTCCACCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-368]  2.7000136937899e-89 PIRSF000390
PIRSF000390   PLP_StrS
 [18-363]  8.19999999999987e-116 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [18-246]  3.49999999999995e-75 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-367]  3.2e-37 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [16-369]  8.79996401030984e-102 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit