close all open/close all

CDS information : Balhi_00310


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction59,344 / 59,961 / + [in whole cluster]
59,344 / 59,961 / + [in contig]
Location59344..59961 [in whole cluster]
59344..59961 [in contig]
TypeCDS
Length618 bp (205 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-3-amino-4-keto-2,3,6-trideoxy-3-C-methyl-D-glucose 5-epimerase
Product (GenBank)putative 3,5 epimerase
Gene
Gene (GenBank)dvaD
EC number5.1.3.-
Keyword
  • dehydrovancosamine
Note
Note (GenBank)
Reference
ACC
Related Reference
ACC
O52806
NITE
Chlor_00270
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)
[12077451] Purification, crystallization and preliminary structural studies of dTDP-4-keto-6-deoxy-glucose-5-epimerase (EvaD) from Amycolatopsis orientalis, the fourth enzyme in the dTDP-L-epivancosamine biosynthetic pathway. (Acta Crystallogr D Biol Crystallogr. , 2002)
[15159413] The position of a key tyrosine in dTDP-4-Keto-6-deoxy-D-glucose-5-epimerase (EvaD) alters the substrate profile for this RmlC-like enzyme. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative dTDP-3-amino-4-keto-2,3,6-trideoxy-3-C-methyl-D-glucose 5-epimerase [putative 3,5 epimerase]
MQARKLAVDGAIEFTPRVFPDDRGLFVSPFQEEAFAEARGGPLFRVAQTNHSMSKRGVVR
GIHYTMTPPGTAKYVYCARGKALDIVVDIRVGSPTFGRWDAVLLDQRDHRAMYFPVGVGH
AFVALEDDTAMWYLLSTAYVARNELALSVLDPALGLPIDADVDPILSERDQVAVTLAEAG
RQGLLPDYATCLELDRQLSEVSLSA
selected fasta
>putative dTDP-3-amino-4-keto-2,3,6-trideoxy-3-C-methyl-D-glucose 5-epimerase [putative 3,5 epimerase]
GTGCAAGCACGCAAACTCGCCGTCGACGGCGCGATCGAGTTCACCCCCCGGGTCTTCCCC
GACGACCGGGGCCTGTTCGTCTCGCCGTTCCAGGAAGAGGCCTTCGCCGAGGCCCGCGGC
GGCCCGCTGTTCCGGGTGGCGCAGACGAACCACAGCATGTCCAAGCGCGGCGTGGTGCGT
GGCATCCACTACACGATGACGCCACCGGGCACGGCCAAGTACGTCTACTGTGCCCGCGGC
AAGGCGTTGGACATCGTGGTCGACATCCGGGTCGGCTCGCCGACGTTCGGCCGGTGGGAC
GCGGTCCTGCTGGACCAGCGGGACCACCGGGCGATGTACTTCCCGGTGGGGGTCGGCCAC
GCGTTCGTGGCCCTCGAGGACGACACCGCCATGTGGTACCTGCTCTCCACGGCCTACGTG
GCGCGGAACGAGCTCGCCCTCTCGGTCCTGGATCCCGCGCTGGGCCTGCCCATCGACGCC
GACGTCGACCCGATCCTGTCCGAACGGGACCAGGTGGCCGTCACGCTCGCCGAGGCGGGA
CGGCAGGGGTTGCTGCCGGACTACGCCACCTGCCTGGAGCTCGACCGGCAGCTGTCCGAA
GTCTCCCTTTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-183]  PD001462
PD001462   dTDP_sugar_isom
 [4-178]  4.30000000000003e-58 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-202]  4.89996723796399e-66 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-190]  3.99999999999998e-59 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit