close all open/close all

CDS information : Balhi_00320


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction60,179 / 61,297 / + [in whole cluster]
60,179 / 61,297 / + [in contig]
Location60179..61297 [in whole cluster]
60179..61297 [in contig]
TypeCDS
Length1,119 bp (372 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)dihydroxyphenylacetic acid synthase
Gene
Gene (GenBank)dpgA
EC number
Keyword
  • type III PKS
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
Related Reference
ACC
O52795
NITE
Chlor_00280
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[12240210] Biosynthesis of the vancomycin group of antibiotics: characterisation of a type III polyketide synthase in the pathway to (S)-3,5-dihydroxyphenylglycine. (Chem Commun (Camb). , 2001)
[14744141] Role of the active site cysteine of DpgA, a bacterial type III polyketide synthase. (Biochemistry. , 2004)
[22492619] Chain elongation and cyclization in type III PKS DpgA. (Chembiochem. , 2012)

close this sectionPKS/NRPS Module

C1
CHS95..370

close this sectionSequence

selected fasta
>polyketide synthase [dihydroxyphenylacetic acid synthase]
MGVDVSMTTSIEPAEDLSVLSGLTEITRFAGVGTAVSASSYSQSEVLDILDVEDPKIRSV
FLNSAIDRRFLTLPPESPGGGRVSEPQGDLLDKHKELAVDMGCRALEACLKSAGATLSDL
RHLCCVTSTGFLTPGLSALIIRELGIDPHCSRSDIVGMGCNAGLNALNVVAGWSAAHPGE
LGVVLCSEACSAAYALDGTMRTAVVNSLFGDGSAALAVISGDGRVPGPRVLKFASYIITD
ALDAMRYDWDRDQDRFSFFLDPQIPYVVGAHAEIVADRLLSGTGLRRSDIGHWLVHSGGK
KVIDSVVVNLGLSRHDVRHTTGVLRDYGNLSSGSFLFSYERLAEEGVTRPGDYGVLMTMG
PGSTIEMALIQW
selected fasta
>polyketide synthase [dihydroxyphenylacetic acid synthase]
GTGGGGGTGGATGTATCGATGACGACCAGCATCGAACCCGCCGAAGACCTTTCGGTCCTC
TCCGGCCTGACCGAGATCACTCGATTCGCCGGCGTGGGAACAGCGGTTTCCGCGTCGTCC
TATTCGCAGTCCGAGGTCCTCGACATCCTCGACGTCGAGGACCCCAAAATCCGCTCGGTC
TTCCTGAACAGCGCCATCGACCGGCGTTTTCTCACCCTGCCGCCGGAGAGTCCCGGTGGG
GGCCGCGTGTCCGAACCGCAGGGCGACCTCCTGGACAAGCACAAGGAGCTCGCGGTCGAC
ATGGGGTGCCGGGCCCTCGAGGCCTGCCTGAAGTCGGCGGGAGCGACGCTTTCGGACCTG
CGTCACCTGTGCTGCGTCACCTCGACCGGGTTCCTGACCCCCGGCCTCAGCGCACTGATC
ATCCGCGAACTGGGGATCGACCCGCACTGCAGCCGCTCGGACATCGTGGGCATGGGGTGC
AACGCCGGCCTGAACGCGCTCAACGTCGTCGCCGGCTGGTCCGCGGCGCACCCGGGTGAA
CTCGGCGTCGTCCTGTGCAGCGAGGCGTGTTCCGCGGCCTACGCCCTGGACGGCACCATG
CGGACCGCGGTGGTCAACAGCCTCTTCGGCGACGGATCCGCCGCACTCGCCGTGATTTCC
GGTGACGGCCGCGTGCCCGGCCCTCGGGTCCTCAAGTTCGCGAGCTACATCATCACCGAC
GCGCTGGACGCCATGCGCTACGACTGGGACCGTGACCAGGACCGGTTCAGCTTCTTCCTC
GACCCGCAGATTCCGTACGTGGTCGGGGCGCACGCGGAGATCGTCGCCGACCGGCTGCTG
TCCGGCACGGGCCTGCGGCGCAGCGACATCGGGCACTGGCTGGTGCATTCCGGCGGCAAG
AAGGTGATCGACTCCGTCGTCGTCAACCTCGGCCTGAGCCGCCACGACGTCCGCCACACC
ACCGGAGTTCTCCGTGACTACGGGAACCTTTCCAGCGGCTCCTTCCTCTTCTCCTACGAG
CGGCTCGCCGAAGAAGGCGTCACCCGGCCCGGAGACTACGGCGTACTCATGACCATGGGG
CCTGGCTCCACAATCGAAATGGCGCTGATCCAATGGTGA
[1] CHS95..370
[1] CHS283..1110

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001099 Chalcone/stilbene synthase, N-terminal (Domain)
 [95-218]  1.9e-14 PF00195
PF00195   Chal_sti_synt_N
IPR011141 Polyketide synthase, type III (Family)
 [1-372]  PIRSF000451
PIRSF000451   PKS_III
IPR012328 Chalcone/stilbene synthase, C-terminal (Domain)
 [257-370]  4.6e-14 PF02797
PF02797   Chal_sti_synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [30-222]  5.79999999999997e-41 G3DSA:3.40.47.10 [229-372]  6.19999999999994e-34 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [87-372]  8.1000073432326e-45 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit