close all open/close all

CDS information : Balhi_00330


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction61,294 / 61,947 / + [in whole cluster]
61,294 / 61,947 / + [in contig]
Location61294..61947 [in whole cluster]
61294..61947 [in contig]
TypeCDS
Length654 bp (217 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)putative enoyl-CoA hydratase
Gene
Gene (GenBank)dpgB
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
Related Reference
ACC
O52796
NITE
Chlor_00290
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [putative enoyl-CoA hydratase]
MNGELVLRLDGTRPLSAASVEELDALCDRVEDHREPGPVTVHVTGVPAAGWTAEVTVGLV
SKWERVVRRFERLGRLTIAVAAGDCAGTALDVLLAADVRIAAPGTRLLLARAGGAPWPGM
TVHRLTRQAGAAGIRRAVLLGAPIEAGRALALNLVDEVSEDPAAALAELAGTAGAVDGKE
LAIRRQLVFEAGSTAFEDALGAHLAAADRALRRETAS
selected fasta
>putative enoyl-CoA hydratase [putative enoyl-CoA hydratase]
GTGAACGGTGAACTGGTGCTCCGGCTCGACGGCACCCGGCCCCTGTCGGCCGCGTCGGTC
GAGGAACTGGACGCCCTCTGCGATCGCGTGGAAGACCACCGGGAACCCGGCCCGGTCACC
GTCCACGTCACGGGTGTCCCGGCCGCCGGCTGGACGGCGGAGGTGACGGTCGGCCTGGTC
TCCAAGTGGGAACGGGTGGTGCGCCGGTTCGAGCGGCTCGGCAGGCTCACCATCGCCGTG
GCGGCGGGTGACTGCGCCGGAACGGCACTGGACGTCCTCCTCGCGGCCGACGTCCGGATC
GCCGCGCCGGGCACCCGGCTGCTGCTCGCCCGGGCCGGCGGCGCGCCGTGGCCCGGGATG
ACCGTGCACCGGCTCACCCGGCAGGCCGGGGCGGCCGGCATCCGGCGGGCGGTGCTGCTC
GGCGCCCCGATCGAGGCCGGTCGCGCGCTGGCCCTGAACCTGGTCGACGAGGTCTCGGAG
GACCCGGCGGCCGCGCTGGCGGAGCTCGCCGGGACGGCCGGTGCCGTGGACGGCAAGGAG
CTGGCGATCCGCCGTCAGCTGGTCTTCGAAGCCGGCTCGACCGCCTTCGAGGACGCACTC
GGCGCCCACCTGGCCGCGGCGGACCGGGCCCTGCGCAGGGAAACCGCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [61-202]  3.1e-09 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit