close all open/close all

CDS information : Balhi_00350


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction63,245 / 64,054 / + [in whole cluster]
63,245 / 64,054 / + [in contig]
Location63245..64054 [in whole cluster]
63245..64054 [in contig]
TypeCDS
Length810 bp (269 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)putative enoyl-CoA-isomerase
Gene
Gene (GenBank)dpgD
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
Related Reference
ACC
O52797
NITE
Chlor_00310
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [putative enoyl-CoA-isomerase]
MSGDRVRYEKKDHVAYVTLDRPGVLNAMDRRTHEELAGIWDDAEADDEVRVVVLTGAGNR
AFSVGQDLKERARLNEAGARATTFGSRGQPGHPRLTDRFTLSKPVVARVHGYALGGGFEL
VLACDIVIASDDSVFALPEVRLGLIPGAGGVFRLPRQLPQKVAMGYLLTGRRMDAATALR
YGLVNEVVPPEELDRCVAEWTDSLVRAAPLSVRAIKEAALRSLDLPLEEAFTASYTWEER
RRRSEDAIEGPRAFAAKRDPVWTGEYRPG
selected fasta
>putative enoyl-CoA hydratase [putative enoyl-CoA-isomerase]
GTGAGCGGCGACCGGGTGCGGTACGAGAAGAAGGACCACGTCGCCTACGTGACGCTGGAC
CGGCCCGGCGTGCTGAACGCCATGGACCGGCGGACGCACGAGGAGCTCGCCGGAATCTGG
GACGACGCCGAGGCCGACGACGAAGTCCGGGTGGTGGTGCTGACCGGCGCCGGGAACCGC
GCGTTCTCCGTCGGCCAGGACCTCAAGGAACGCGCCCGGCTGAACGAAGCGGGTGCGCGG
GCCACGACGTTCGGCAGCCGGGGCCAGCCGGGGCATCCCCGGCTGACCGACCGGTTCACC
CTGTCCAAGCCGGTGGTCGCCCGGGTGCACGGCTACGCGCTGGGCGGTGGCTTCGAGCTG
GTGCTCGCCTGCGACATCGTCATCGCCTCCGACGATTCGGTGTTCGCCCTGCCGGAGGTC
CGCCTCGGCCTGATCCCCGGGGCGGGCGGGGTGTTCCGGCTGCCGCGGCAGCTGCCGCAG
AAGGTGGCGATGGGCTACCTGCTGACCGGCCGCCGGATGGACGCGGCGACGGCGCTGCGG
TACGGATTGGTCAACGAGGTCGTGCCACCGGAGGAACTGGACCGGTGCGTCGCCGAATGG
ACGGACAGCCTCGTGCGCGCCGCTCCGCTTTCGGTTCGCGCGATCAAGGAGGCCGCGCTA
CGGTCGCTCGACCTCCCCCTGGAGGAGGCGTTCACCGCTTCCTACACCTGGGAAGAGCGC
CGTCGGCGGAGCGAAGACGCGATCGAGGGTCCCCGGGCCTTCGCCGCGAAACGGGATCCG
GTCTGGACCGGGGAATACCGGCCGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [8-256]  3.89999999999997e-60 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [106-126]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit