close all open/close all
Balhi_00360 Balhi_00360   last last

CDS information : Balhi_00370


close this sectionLocation

Organism
StrainDSM 5908
Entry nameBalhimycin
Contig
Start / Stop / Direction65,378 / 66,669 / + [in whole cluster]
65,378 / 66,669 / + [in contig]
Location65378..66669 [in whole cluster]
65378..66669 [in contig]
TypeCDS
Length1,292 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative type I polyketide synthase
Gene
Gene (GenBank)pks
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in balhimycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative type I polyketide synthase]
MEEIRTEFIRPLLTSLSAHAADRPAYSDDRRTLTYGGLAHAAAELAAGLGVARGDRVLVH
VGSRVEFAVALLAVLRAAAVGVPVSVRSTDAELAHLAADSGATLLVTEARHAAAAERLRR
DRPGLRVLFVDDPPPARVGEPRDDLGLDEPAWLLYTSGTTGRPKGVLLSQRAMLWSTAAY
YVPMLGLDAEDTVLWPLPTHHAYALSLAFVTTIALGAHTRLADGCTPDLLARYPGSVLAG
VPALYLRLRQESGGPLAAPRLCLSGGAPCTPATRAAVRDLFGLPVADGYGSTETGGKVAA
ELPGEAGLVPVPGLEIRIDAGEVLVRGPGLMLGYHGRTESPLRDGWYRTGDAGRFEGGRL
VLEGRVDDVIVCGGQNVHPAEIEAVLEESPSVRDVLVLGRPDDVLGEVPVAFVVAGPGGF
DAEELRGRCL-
selected fasta
>[putative type I polyketide synthase]
GTGGAGGAAATCCGGACAGAGTTCATCCGACCGCTGCTGACATCGTTGTCCGCGCACGCC
GCGGACCGCCCCGCCTACTCCGACGACCGGCGAACGCTGACCTACGGCGGGCTGGCCCAC
GCCGCCGCGGAGCTCGCCGCCGGGCTCGGGGTGGCCCGGGGCGACCGCGTGCTGGTGCAC
GTCGGCAGCCGGGTCGAGTTCGCCGTCGCCCTGCTGGCGGTGCTGCGGGCGGCGGCCGTG
GGAGTCCCGGTGAGCGTGCGCTCGACCGACGCCGAACTCGCCCACCTGGCGGCCGATTCG
GGGGCGACGCTCCTGGTCACGGAGGCGCGGCACGCCGCCGCGGCCGAACGGCTGCGCCGC
GACCGGCCCGGTCTGCGGGTTCTCTTCGTCGACGATCCGCCGCCCGCGCGGGTGGGCGAG
CCGCGCGACGACCTCGGACTGGACGAGCCGGCTTGGCTGCTCTACACCTCCGGCACCACC
GGCCGGCCCAAGGGCGTCCTGCTCTCGCAGCGCGCGATGCTGTGGTCGACGGCCGCGTAC
TACGTCCCCATGCTCGGGCTCGACGCCGAAGACACCGTGCTGTGGCCGTTGCCGACGCAC
CACGCGTACGCCCTGTCGCTGGCGTTCGTCACCACGATCGCGCTGGGGGCGCACACCCGG
CTGGCCGACGGGTGCACGCCGGACCTGCTCGCCCGGTACCCCGGCAGTGTGCTCGCCGGT
GTTCCCGCGCTCTACCTCCGGCTCCGCCAGGAGTCCGGCGGTCCCCTCGCCGCGCCGCGG
CTGTGCCTGAGCGGCGGCGCGCCGTGCACGCCGGCGACCCGGGCCGCGGTCCGGGACCTG
TTCGGGCTCCCGGTGGCCGACGGCTACGGGAGCACCGAGACGGGCGGGAAGGTCGCCGCC
GAGCTTCCCGGTGAAGCGGGCCTGGTCCCGGTGCCCGGCTTGGAGATCCGGATCGACGCG
GGGGAGGTGCTCGTCCGCGGTCCCGGGCTGATGCTGGGCTACCACGGGCGAACCGAATCA
CCGCTGCGGGACGGCTGGTACCGCACGGGCGACGCCGGCCGGTTCGAGGGCGGCCGGCTC
GTGCTCGAGGGCCGCGTGGACGACGTGATCGTCTGCGGTGGCCAGAACGTCCACCCTGCC
GAAATCGAGGCGGTGCTCGAAGAGTCGCCTTCGGTGCGGGACGTCCTCGTGCTCGGCCGT
CCCGACGACGTCCTGGGCGAGGTGCCGGTGGCGTTCGTGGTCGCCGGGCCCGGCGGCTTC
GACGCCGAGGAGCTGCGTGGCCGGTGTCTAGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [34-397]  5e-74 PF00501
PF00501   AMP-binding
IPR020459 AMP-binding (Domain)
 [148-159]  0.0001 PR00154 [160-168]  0.0001 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [153-164]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit
Balhi_00360 Balhi_00360   last last