close all open/close all
first first   Bena_00020 Bena_00020

CDS information : Bena_00010


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction951 / 1 / - [in whole cluster]
951 / 1 / - [in contig]
Locationcomplement(1..951) [in whole cluster]
complement(1..951) [in contig]
TypeCDS
Length951 bp (316 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative phosphotransferase
Product (GenBank)
GenebenK
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original reference table.
Note (GenBank)
Reference
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Family/Domain
FD
IPR011611, IPR002173

close this sectionSequence

selected fasta
>putative phosphotransferase
MRIAITGSVATDHLMTFPGRIADQFLPDRLDRVSLSFLVDTLEVRDGGVAANIAYGLALL
GHRPLLIASVGTDFAEYGARLAALGVDLSAIRVSPTRHTARFLCTTDTDGNQLASFYPGA
MSEAPAIDLTAVLRQRGGADLVLVGADAPEAMARHTRTCRSMGVRFVADPSQQLARLDGP
QIRGLVAGADHLFTNEYERELLLAKTGWAPEDVLAQVSTWVTTRAEKGSRVEQTGRPPSE
VPAVPVATPVDPTGVGDAFRAGYLSALAAGGDPVRCARAGSALAALALTTVGTQTYTLAS
GGSDDLVTAPVQGTSM
selected fasta
>putative phosphotransferase
ATGCGCATCGCGATCACCGGTTCGGTCGCCACGGACCATCTCATGACCTTCCCCGGCCGC
ATCGCCGACCAGTTCCTGCCCGACCGCCTGGACCGTGTCTCCCTCTCCTTCCTCGTGGAC
ACTCTGGAGGTTCGGGACGGCGGAGTCGCGGCCAACATCGCCTACGGGCTCGCCCTGCTC
GGCCACCGACCGCTCCTGATCGCCTCGGTCGGGACGGACTTCGCGGAGTACGGTGCCCGG
CTGGCCGCCCTGGGAGTGGACCTCTCCGCCATCAGAGTCTCCCCCACCCGCCATACCGCC
CGCTTTCTGTGCACGACGGACACGGACGGCAACCAGCTCGCTTCCTTCTACCCGGGGGCG
ATGAGCGAGGCGCCCGCCATTGACCTCACCGCCGTACTGCGACAGCGCGGCGGCGCCGAT
CTCGTGCTCGTCGGTGCCGACGCCCCCGAGGCGATGGCGCGCCACACCAGGACCTGTCGC
TCCATGGGCGTGCGCTTCGTCGCCGACCCTTCCCAGCAACTGGCCCGGCTCGACGGCCCG
CAGATCCGGGGGCTCGTCGCCGGGGCGGACCACCTGTTCACGAACGAGTACGAACGCGAA
CTGCTCCTCGCCAAGACAGGCTGGGCCCCGGAGGACGTACTGGCGCAGGTCTCCACCTGG
GTGACCACCCGCGCCGAGAAGGGCAGCCGCGTCGAGCAGACCGGCAGGCCGCCGTCCGAG
GTCCCGGCCGTGCCCGTCGCGACGCCGGTCGACCCGACAGGGGTTGGTGACGCCTTCCGC
GCCGGCTATCTGTCGGCTCTCGCTGCGGGTGGTGATCCGGTTCGGTGCGCTCGGGCGGGC
TCGGCCCTCGCCGCCCTGGCCCTCACCACCGTCGGCACCCAGACGTACACGCTGGCCTCA
GGCGGATCGGACGACCTCGTCACAGCACCGGTCCAGGGCACCTCGATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002173 Carbohydrate/puine kinase, PfkB, conserved site (Conserved_site)
 [47-71]  PS00583
PS00583   PFKB_KINASES_1
IPR011611 PfkB (Domain)
 [32-295]  1.7e-42 PF00294
PF00294   PfkB
SignalP No significant hit
TMHMM No significant hit
first first   Bena_00020 Bena_00020