close all open/close all

CDS information : Bena_00020


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction2,146 / 953 / - [in whole cluster]
2,146 / 953 / - [in contig]
Locationcomplement(953..2146) [in whole cluster]
complement(953..2146) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative S-adenosylmethionine synthetase
putative methionine adenosyltransferase
Product (GenBank)
GenebenM
metK
Gene (GenBank)
EC number2.5.1.6
Keyword
  • SAM
Note
Note (GenBank)
Reference
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q938W7
PmId
[11594346] Influence of ancillary genes, encoding aspects of methionine metabolism, on tylosin biosynthesis in Streptomyces fradiae. (J Antibiot (Tokyo). , 2001)
Family/Domain
FD
IPR002133

close this sectionSequence

selected fasta
>putative S-adenosylmethionine synthetase
MSRKLFTSESVTEGHPDKMADRISDTILDALLKEDPLSRVAVETLITTGQVHVAGEVTTT
AYADIPALVRDAVLDIGYDSSTKGFDGASCGVSVSIGAQSPDIARGVDTGVAGADRLDAQ
GAGDQGLMFGFACDETPELMPLPIRLAHRLAYRLTQVRKNGTMPYLRPDGKTQVTVEYLG
GTRVRLDTVVVSAQHAGDIDLQELLVPDVRRHVVEHELARPADDGIELDTDGFRLLVNPT
GRFHIGGPMGDAGLTGRKIVIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVA
AGLASRCEVQVAYAIGRADPVGLFVETFGTATVSPTAIEKAISAVFDLRPAAIIRDLDLL
RPIYAQTAAYGHFGRELPDFTWERTDRAVALRDATGA
selected fasta
>putative S-adenosylmethionine synthetase
ATGTCCCGCAAACTGTTCACCTCGGAGTCCGTCACCGAGGGGCATCCCGACAAAATGGCG
GACCGGATCAGCGACACGATCCTCGACGCCCTGCTCAAGGAAGACCCCCTGTCGCGCGTC
GCCGTGGAGACCCTGATCACCACCGGCCAGGTGCACGTGGCCGGCGAGGTGACCACCACG
GCGTACGCGGACATCCCCGCCCTGGTGCGCGACGCGGTGCTCGACATCGGATACGACTCA
TCCACCAAGGGTTTCGACGGCGCCTCCTGCGGTGTCTCGGTCTCCATCGGCGCCCAGTCG
CCCGACATCGCCCGGGGTGTGGACACCGGCGTAGCGGGTGCCGACCGGCTGGACGCACAG
GGCGCCGGAGACCAGGGCCTGATGTTCGGCTTTGCCTGCGACGAGACGCCGGAGTTGATG
CCGCTGCCCATCCGGTTGGCGCATCGACTCGCGTACCGGCTGACGCAGGTCCGCAAGAAC
GGCACCATGCCGTACCTGCGCCCGGACGGAAAGACACAGGTGACGGTCGAGTACCTGGGC
GGCACCCGAGTCCGCCTCGACACCGTGGTGGTGTCGGCCCAGCACGCAGGGGACATCGAC
TTGCAGGAACTGCTGGTGCCGGACGTCCGCCGGCACGTCGTCGAGCACGAACTCGCACGG
CCGGCCGACGACGGCATCGAACTCGACACCGACGGCTTCCGGTTGCTGGTCAACCCCACC
GGCCGATTCCACATCGGTGGTCCGATGGGGGACGCGGGCCTGACCGGCCGCAAGATCGTC
ATCGACACGTACGGCGGCATGGCCCGTCACGGCGGCGGAGCCTTTTCCGGCAAGGACCCG
TCCAAGGTGGACCGCAGTGCCGCCTACGCCATGCGCTGGGTCGCCAAGAACGTGGTCGCG
GCGGGCCTGGCCTCCCGCTGCGAGGTCCAGGTCGCCTACGCCATCGGCAGGGCGGACCCG
GTCGGTCTCTTCGTGGAGACCTTCGGCACCGCCACCGTCTCCCCCACCGCGATCGAAAAG
GCCATCAGCGCCGTCTTCGACCTCCGCCCGGCCGCCATCATCCGCGACCTCGACCTGCTT
CGCCCGATCTACGCCCAGACGGCGGCGTACGGCCACTTCGGTCGCGAGCTACCGGACTTC
ACCTGGGAGCGGACCGACCGGGCCGTCGCTCTCCGCGATGCGACGGGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002133 S-adenosylmethionine synthetase (Family)
 [5-393]  2.7e-159 TIGR01034
TIGR01034   metK: methionine adenosyltransferase
 [2-395]  54.01 MF_00086
MF_00086   S_AdoMet_synth1
IPR022628 S-adenosylmethionine synthetase, N-terminal (Domain)
 [3-101]  1.9e-39 PF00438
PF00438   S-AdoMet_synt_N
IPR022629 S-adenosylmethionine synthetase, central domain (Domain)
 [119-243]  8.4e-43 PF02772
PF02772   S-AdoMet_synt_M
IPR022630 S-adenosylmethionine synthetase, C-terminal (Domain)
 [245-384]  7e-67 PF02773
PF02773   S-AdoMet_synt_C
IPR022631 S-adenosylmethionine synthetase, conserved site (Conserved_site)
 [271-279]  PS00377
PS00377   ADOMET_SYNTHASE_2
 [121-131]  PS00376
PS00376   ADOMET_SYNTHASE_1
IPR022636 S-adenosylmethionine synthetase superfamily (Domain)
 [2-103]  4.2e-42 SSF55973 [114-244]  1.1e-39 SSF55973 [245-390]  2.3e-74 SSF55973
SSF55973   S-adenosylmethionine synthetase
SignalP No significant hit
TMHMM No significant hit