close all open/close all

CDS information : Bena_00030


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction2,573 / 2,184 / - [in whole cluster]
2,573 / 2,184 / - [in contig]
Locationcomplement(2184..2573) [in whole cluster]
complement(2184..2573) [in contig]
TypeCDS
Length390 bp (129 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
GenebenN
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein
MRKPSAAVPAVPIPMLLPPLPVPAESTSLAGRRITVLGQGGSARAIAAKLGAHGATVDLH
PPGRSIQFPDPGRARQRLDGVLVLLPRTGEAVASDAIATAMGCSPRWLLVLAAGTDPAEA
GRAALALDR
selected fasta
>hypothetical protein
ATGAGGAAGCCCAGTGCCGCCGTTCCGGCCGTGCCGATCCCCATGCTCCTGCCGCCCCTG
CCCGTCCCTGCCGAGTCGACCTCGCTGGCCGGCCGGCGCATCACCGTCCTCGGCCAGGGG
GGTTCGGCCCGCGCCATCGCGGCGAAGCTCGGCGCCCACGGTGCCACGGTCGACCTCCAC
CCACCCGGACGCTCGATCCAGTTCCCTGACCCAGGTCGGGCCCGCCAGCGGCTCGACGGC
GTTCTCGTGCTGCTTCCCAGGACGGGAGAAGCCGTCGCCTCCGACGCCATCGCCACGGCC
ATGGGGTGCTCGCCCCGCTGGCTGCTCGTCCTGGCCGCGGGGACCGATCCCGCCGAGGCA
GGACGGGCAGCCCTGGCCCTCGACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
No significant hit
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [26-55]  0.00057 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-24]  0.537 Signal
Bacteria, Gram-positive   
TMHMM No significant hit