close all open/close all

CDS information : Bena_00040


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction4,108 / 2,570 / - [in whole cluster]
4,108 / 2,570 / - [in contig]
Locationcomplement(2570..4108) [in whole cluster]
complement(2570..4108) [in contig]
TypeCDS
Length1,539 bp (512 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)
GenebenT
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance transporter
MTAAPDPRRWWGLAVIGLAQLLVVLDATVMSIALPHAQDSLNMSDGSRQWVITAYTLAFG
GLLLVGGQVADRVGYKRTFVIGVIGFVVASTLGGAAPTAGLLFAARALQGVFAALLAPSA
LALLTTTFHDPGERAKAVGVFGAIAGAGSVVGLIAGGLLTEYLSWRWCLYVNLPPGAVVV
GAALIVLRDRRGNSGARPDLPGVLLACPGLVAVTAGFGAAAARGWGDAMVLGLLAGGAIL
LAVFARWQTITRTPLLPPRIVRSRVRTGAYFTMALVTIGLFALFLSVTYYLQTVLGYSPL
KTGLAFLPAAVGIIVGATGISARLSHRVPPRGLIVPGMLLAAAGMLLLTGLGTEPAYLSH
VLPAEFMVGLGTGTTFMAAIGSASLGVDPRETGIASATLTTAQQIGGSMGVALLNTVASS
AAQRYESARTGAEPEPGAAVERAATVHGFAVASGWVAALLALGAVAVGFVLVTRTQPPES
SIGTGSVERPGDAPPAVPARRQPPANSGGNHP
selected fasta
>putative drug resistance transporter
ATGACTGCCGCACCCGATCCGCGACGCTGGTGGGGACTCGCCGTCATCGGCCTCGCCCAG
CTGTTGGTGGTGCTCGACGCCACGGTCATGAGCATCGCCCTCCCGCACGCCCAGGACAGC
CTCAACATGAGTGACGGCAGCCGGCAGTGGGTCATCACCGCCTACACCCTTGCGTTCGGC
GGACTGTTGCTCGTTGGCGGCCAGGTCGCCGACCGCGTCGGGTACAAGCGCACGTTCGTC
ATCGGTGTCATCGGATTCGTGGTCGCCTCCACGCTGGGCGGCGCGGCACCCACGGCGGGA
CTGCTGTTCGCGGCGCGAGCCCTCCAGGGCGTGTTCGCCGCGCTGCTCGCACCGTCCGCG
CTCGCCCTGCTCACGACGACCTTCCATGACCCCGGCGAACGCGCCAAGGCTGTCGGCGTG
TTCGGCGCGATCGCCGGAGCGGGCTCGGTGGTCGGCCTGATCGCCGGTGGTCTGCTCACC
GAGTACCTGAGCTGGCGGTGGTGTCTGTACGTCAATCTGCCGCCCGGCGCCGTCGTTGTG
GGCGCAGCGCTGATCGTGCTGCGCGATCGGCGGGGGAACTCCGGTGCCCGCCCGGACCTC
CCGGGTGTGCTGCTGGCCTGCCCCGGCCTCGTCGCCGTGACCGCAGGTTTCGGAGCGGCG
GCCGCACGCGGCTGGGGAGATGCCATGGTGCTGGGCCTGCTCGCCGGGGGCGCCATCCTG
CTCGCCGTATTCGCCCGCTGGCAGACCATCACACGGACGCCGCTGTTGCCGCCCCGCATC
GTGCGCAGCCGGGTGCGCACGGGTGCCTACTTCACCATGGCGCTGGTCACCATAGGGCTG
TTCGCCCTGTTCCTGTCCGTCACGTACTACCTGCAGACCGTCCTCGGCTACTCCCCGCTC
AAGACCGGCCTGGCCTTCCTGCCGGCTGCCGTCGGCATCATCGTCGGCGCGACCGGGATC
TCCGCCCGGCTCAGCCACCGGGTGCCACCGCGTGGGCTGATCGTGCCGGGCATGCTGCTG
GCCGCGGCCGGGATGCTGCTGCTCACCGGGCTCGGCACGGAGCCGGCGTATCTCTCGCAC
GTCCTGCCGGCGGAGTTCATGGTGGGGCTGGGCACCGGTACCACCTTCATGGCCGCGATC
GGCAGCGCCTCGCTGGGCGTCGACCCCCGGGAAACAGGCATCGCCTCGGCCACCCTCACC
ACGGCACAGCAGATCGGCGGATCCATGGGCGTCGCGCTGCTGAACACGGTGGCGAGCAGC
GCGGCACAGCGGTACGAGAGCGCGCGCACCGGCGCAGAGCCGGAGCCCGGTGCGGCCGTC
GAACGGGCCGCCACGGTGCACGGGTTCGCGGTGGCATCCGGCTGGGTCGCGGCCCTGCTG
GCCCTGGGAGCGGTCGCCGTGGGGTTCGTGCTCGTCACCCGGACCCAGCCGCCTGAGTCC
TCCATCGGAACCGGATCGGTGGAGCGTCCCGGCGACGCGCCGCCGGCCGTTCCGGCCCGA
CGTCAACCACCCGCGAATTCCGGAGGTAACCACCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [17-410]  9.7e-48 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-470]  7.2e-64 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [12-476]  33.539 PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [12-34]  Transmembrane (i-o) [49-66]  Transmembrane (o-i) [79-101]  Transmembrane (i-o) [105-124]  Transmembrane (o-i) [137-159]  Transmembrane (i-o) [169-187]  Transmembrane (o-i) [200-222]  Transmembrane (i-o) [228-247]  Transmembrane (o-i) [268-290]  Transmembrane (i-o) [303-325]  Transmembrane (o-i) [332-351]  Transmembrane (i-o) [366-387]  Transmembrane (o-i) [451-473]  Transmembrane (i-o)
Transmembrane 13