close all open/close all

CDS information : Bena_00050


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction4,243 / 4,698 / + [in whole cluster]
4,243 / 4,698 / + [in contig]
Location4243..4698 [in whole cluster]
4243..4698 [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)BenG protein
Gene
Gene (GenBank)benG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q2MGC4
NITE
Fred_00150
PmId
[19620242] In vivo investigation of the roles of FdmM and FdmM1 in fredericamycin biosynthesis unveiling a new family of oxygenases. (J Biol Chem. , 2009)
ACC
Q2MGC3
NITE
Fred_00160
PmId
[19620242] In vivo investigation of the roles of FdmM and FdmM1 in fredericamycin biosynthesis unveiling a new family of oxygenases. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative oxidoreductase [BenG protein]
MTEALSVLSIVVSGAVLGGLLIGLLVIEPVLRGLKVDHYRLMNTLLAYRMDKLMPALVVL
ATLGDVALAVTVDRRAAAVLYGLAAAFLCAIAIVSRLTARPLYEWVERIDPTDPPPDWED
VRPRWRTLHRVRVGLGAVAVSLGAVAAAVSL
selected fasta
>putative oxidoreductase [BenG protein]
GTGACCGAGGCACTGAGTGTGCTGTCGATCGTGGTGAGCGGTGCGGTGTTGGGCGGTCTG
CTGATCGGCCTGCTGGTGATCGAGCCCGTGCTGCGAGGGCTGAAGGTCGATCACTATCGG
CTGATGAACACGCTGCTCGCCTACCGGATGGACAAGCTGATGCCGGCTTTGGTGGTGCTC
GCGACGCTCGGCGACGTGGCCCTGGCGGTCACCGTGGACCGAAGGGCGGCGGCGGTGCTG
TACGGACTCGCGGCGGCGTTCCTCTGCGCGATCGCCATCGTCTCCCGTCTCACGGCACGG
CCGCTGTACGAGTGGGTCGAGCGGATCGATCCGACTGATCCGCCGCCGGACTGGGAGGAC
GTACGGCCGCGATGGCGCACCCTCCACCGAGTACGCGTCGGACTCGGCGCCGTGGCCGTC
TCGCTCGGCGCGGTGGCCGCGGCGGTCAGCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013901 Protein of unknown function DUF1772 (Family)
 [22-147]  3.90000000000001e-15 PF08592
PF08592   DUF1772
SignalP
 [1-33]  0.614 Signal
Eukaryota   
 [1-18]  0.641 Signal
Bacteria, Gram-negative   
TMHMM
 [10-32]  Transmembrane (o-i) [53-72]  Transmembrane (i-o) [77-99]  Transmembrane (o-i) [131-150]  Transmembrane (i-o)
Transmembrane 4