close all open/close all

CDS information : Bena_00060


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction6,045 / 4,867 / - [in whole cluster]
6,045 / 4,867 / - [in contig]
Locationcomplement(4867..6045) [in whole cluster]
complement(4867..6045) [in contig]
TypeCDS
Length1,179 bp (392 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productdimethyltransferase
Product (GenBank)BenF protein
Gene
Gene (GenBank)benF
EC number2.1.1.-
Keyword
  • SAM
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
[17691088] Geminal bismethylation prevents polyketide oxidation and dimerization in the benastatin pathway. (Angew Chem Int Ed Engl. , 2007)

close this sectionSequence

selected fasta
>dimethyltransferase [BenF protein]
MVRLAAHWSRWDGAPPVRGQRPTSALGQGRGRQNLEPASIARESMTVSQPAGDAGLRKLG
ELAFAAGNAAAVQTATRLKIPDMIGDKPVPVEELAEKAGLEPQLLYRLLRALTTYGVFEE
VGERTFAHTDMSLPLREDSLDGIRNLILWIGAPWTWQAWPRLEEALRTGKSVIPSLYGKE
FYDYLREDAPDDEQLFARAMTDSSARSSDVVAQTIDLTGVGTVVDIGGGQGLLLRTLLDR
FPKLNGVLFDFEQVLAGAHEDLKDGGRLASRTRIVPGNCLESVPVEADVYILKNLVEWPD
ENSRAVLRNITASAPPGARVIIIDSLVDAHPDEMRITTTLDLFLMMNVGGQKHSLADFDP
MFAEAGIKKLSVHTVPGTLPRLHLVEGLLHRG
selected fasta
>dimethyltransferase [BenF protein]
GTGGTACGCCTGGCGGCCCACTGGTCGCGGTGGGACGGCGCGCCACCAGTGCGGGGACAG
CGACCCACCAGCGCCCTCGGCCAAGGTCGGGGCCGTCAGAACCTGGAGCCCGCATCGATC
GCGAGGGAATCCATGACCGTTTCGCAACCGGCCGGGGACGCCGGCCTCCGAAAGCTGGGT
GAGCTGGCCTTCGCAGCCGGGAACGCCGCTGCCGTTCAGACGGCAACCCGGCTGAAGATC
CCCGACATGATCGGCGACAAGCCCGTCCCGGTCGAGGAGCTCGCCGAGAAGGCGGGTCTC
GAACCTCAGCTGCTGTATCGGCTGTTGCGCGCCCTGACCACTTACGGCGTGTTCGAGGAG
GTCGGTGAGCGGACCTTCGCGCACACCGACATGTCGCTGCCCCTGCGTGAGGACTCACTC
GACGGCATCCGCAACCTCATCCTGTGGATCGGCGCGCCGTGGACCTGGCAGGCGTGGCCG
CGCCTGGAGGAGGCGCTGCGTACCGGCAAGTCCGTCATCCCGTCCCTCTACGGCAAGGAG
TTCTACGACTACCTGCGAGAGGACGCACCCGACGACGAGCAGCTGTTCGCGCGGGCCATG
ACGGACTCCAGCGCGCGCAGCTCCGACGTGGTCGCGCAGACCATCGACCTGACCGGCGTC
GGCACCGTCGTGGACATCGGCGGCGGCCAGGGCCTGCTGCTGCGCACCCTGCTCGACCGG
TTCCCGAAGCTCAACGGCGTCCTGTTCGACTTCGAGCAGGTGTTGGCCGGCGCCCACGAG
GACCTCAAGGACGGCGGCAGGCTCGCCTCCCGGACCAGGATCGTGCCGGGCAACTGCCTG
GAGTCGGTGCCTGTCGAGGCGGACGTCTACATCCTGAAGAACCTCGTGGAATGGCCGGAC
GAGAACTCCCGGGCCGTGCTCCGCAACATCACCGCCAGCGCTCCGCCCGGAGCACGGGTG
ATCATCATCGACAGCCTGGTGGATGCCCACCCCGACGAGATGCGGATCACCACGACGCTC
GACCTGTTCCTGATGATGAACGTCGGCGGACAGAAGCACAGCCTCGCCGACTTCGACCCG
ATGTTCGCGGAGGCCGGAATCAAGAAGCTGAGCGTGCACACCGTCCCGGGCACGCTGCCG
CGACTGCACCTGGTCGAGGGCCTGTTGCACCGGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [125-360]  1.99999999999999e-41 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [57-130]  1.7e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [39-381]  1.80000149287192e-12 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-19]  0.28 Signal
Eukaryota   
TMHMM No significant hit