close all open/close all

CDS information : Bena_00070


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction6,112 / 6,432 / + [in whole cluster]
6,112 / 6,432 / + [in contig]
Location6112..6432 [in whole cluster]
6112..6432 [in contig]
TypeCDS
Length321 bp (106 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)BenE protein
Gene
Gene (GenBank)benE
EC number
Keyword
  • pentangular
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
P39890
PmId
[8218177] Tetracenomycin F2 cyclase: intramolecular aldol condensation in the biosynthesis of tetracenomycin C in Streptomyces glaucescens. (Biochemistry. , 1993)

close this sectionSequence

selected fasta
>putative cyclase [BenE protein]
MHRTLIVARMKPEDADKVADLFRWSDSTELPHLIGARQRTLFRFHDLYMHLVEADEDPTQ
KLYAAREHPLFKELHERLLPFITAYDPKWSEPKHAMALPFYTWQAD
selected fasta
>putative cyclase [BenE protein]
ATGCACCGCACTTTGATCGTGGCGCGGATGAAACCCGAAGACGCCGACAAGGTCGCCGAC
CTGTTCCGCTGGTCGGACAGCACGGAACTGCCGCATCTCATCGGCGCACGGCAACGCACG
CTCTTCCGCTTCCACGACCTGTACATGCACCTCGTGGAGGCCGACGAGGACCCCACGCAG
AAACTGTACGCGGCACGGGAGCACCCGCTCTTCAAGGAGCTCCACGAGAGGCTGCTGCCA
TTCATCACCGCGTACGACCCCAAGTGGTCCGAGCCCAAGCACGCCATGGCGCTGCCGTTC
TACACCTGGCAGGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [2-103]  PD012644
PD012644   Polyketide_synth_cyclase
 [1-105]  2.8e-47 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
 [10-105]  2.70000000000002e-36 PF04673
PF04673   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-106]  1.70000295590053e-44 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit