close all open/close all

CDS information : Bena_00080


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction6,432 / 6,875 / + [in whole cluster]
6,432 / 6,875 / + [in contig]
Location6432..6875 [in whole cluster]
6432..6875 [in contig]
TypeCDS
Length444 bp (147 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)BenD protein
Gene
Gene (GenBank)benD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
P23157
PmId
[15701630] A novel quinone-forming monooxygenase family involved in modification of aromatic polyketides. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative oxidoreductase [BenD protein]
MSAHEAHTVPPTGTAELLVTKVAAGDVPSSPRHGGDLRIVLGPATTGVSSGFMGTGLLAV
GERIREHYHPYSDEFLYVVQGGLEVTTEGTDVHRVTAGEGILIPRMTRHKMLNDGTVPAF
VVFHSCPLAPRPELGHVDTEEADPDEQ
selected fasta
>putative oxidoreductase [BenD protein]
ATGTCCGCCCACGAAGCACACACCGTCCCGCCGACGGGGACGGCGGAGCTCCTCGTCACC
AAGGTCGCCGCCGGGGACGTCCCGTCGAGCCCTCGGCACGGAGGCGATCTGCGGATCGTC
CTCGGTCCGGCGACGACCGGAGTGAGCAGCGGCTTCATGGGCACCGGCCTGCTGGCCGTC
GGTGAACGGATCAGGGAGCACTACCACCCGTACTCGGACGAGTTCCTGTACGTGGTGCAG
GGCGGTCTGGAAGTGACGACGGAGGGCACGGACGTCCACCGGGTGACGGCGGGCGAGGGC
ATCCTCATCCCGCGTATGACCAGGCACAAGATGCTCAACGACGGCACTGTGCCGGCGTTC
GTCGTCTTCCACTCGTGCCCGCTCGCTCCCCGTCCCGAGCTGGGTCATGTCGACACGGAG
GAGGCTGATCCCGATGAGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [1-144]  2.39999798157265e-19 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [57-122]  4.2e-16 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [55-129]  3.7e-18 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP
 [1-25]  0.158 Signal
Eukaryota   
TMHMM
 [39-61]  Transmembrane (o-i)
Transmembrane 1