close all open/close all

CDS information : Bena_00090


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction6,865 / 8,136 / + [in whole cluster]
6,865 / 8,136 / + [in contig]
Location6865..8136 [in whole cluster]
6865..8136 [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)BenA protein
Gene
Gene (GenBank)benA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS5..376

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [BenA protein]
MSSERRAVITGMGVIAPGGVGTRAFWSAVTAGRTATRRITLFDPERFRCRIAAECDFDAA
ALGLTPQEIRRMDRAVQMAVAATGEALADAGVGEGDLDPARTGVTIGNAVGSTMMMEEEY
VVISDGGRKWLCDEEYGVRHLYGAVIPSTAGVEVARRVGAEGPTAVVSTGCTSGLDAVGH
AAQLIEEGSADVVIGGATDAPISPITVACFDSLKATSTRNDDAEHACRPFDRDRDGLVLG
EGSAVFVMEARERAVRRGAKIYCEVAGYAGRANAYHMTGLKPDGRELAEAIDRAMAQAGI
SAEDIDYVNAHGSGTRQNDRHETAAFKRSLRDHARRVPVSSIKSMVGHSLGAIGAIEVAA
SALAIEHGVVPPTANLTTPDPECDLDYVPREAREHPTDVVLSVGSGFGGFQSAVVLISPR
SRR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [BenA protein]
ATGAGCAGTGAACGACGTGCCGTCATCACCGGGATGGGAGTCATAGCTCCAGGCGGGGTC
GGTACCCGCGCCTTCTGGTCCGCGGTGACCGCGGGCCGGACGGCCACGCGCCGGATCACC
CTGTTCGACCCGGAGCGGTTCCGCTGCCGGATCGCGGCGGAGTGCGACTTCGACGCGGCC
GCACTGGGCCTGACTCCACAGGAGATCCGCCGGATGGACCGGGCCGTGCAGATGGCGGTG
GCCGCCACCGGCGAGGCACTCGCGGACGCGGGGGTCGGCGAGGGCGACCTGGATCCGGCC
CGTACCGGTGTCACCATCGGCAACGCGGTCGGCAGCACGATGATGATGGAGGAGGAGTAC
GTCGTCATCAGCGACGGCGGCCGCAAGTGGCTGTGCGACGAGGAATATGGCGTACGGCAC
CTGTACGGCGCGGTCATCCCGAGTACCGCAGGGGTGGAGGTGGCGCGTCGCGTCGGCGCG
GAGGGACCGACGGCGGTGGTGTCGACCGGCTGCACGTCCGGGCTCGACGCGGTCGGGCAC
GCCGCGCAGCTGATCGAGGAGGGCTCCGCGGACGTGGTGATCGGTGGTGCCACGGACGCC
CCGATCTCGCCGATCACGGTGGCCTGCTTCGACTCGCTGAAGGCCACCTCGACCCGCAAC
GACGACGCGGAACACGCCTGCCGCCCCTTCGACCGGGACCGCGACGGGCTGGTGCTGGGC
GAGGGGTCCGCGGTCTTCGTGATGGAGGCGAGGGAGCGGGCCGTACGGCGCGGCGCGAAG
ATCTACTGTGAGGTGGCCGGCTACGCCGGACGTGCCAACGCCTATCACATGACCGGTCTG
AAGCCGGACGGCCGGGAACTGGCCGAGGCCATCGACCGGGCCATGGCGCAGGCCGGCATC
TCGGCCGAGGACATCGACTACGTCAACGCGCACGGATCGGGCACGCGGCAGAACGACCGG
CACGAGACAGCCGCGTTCAAGCGAAGCCTGAGGGACCACGCCCGCCGTGTCCCGGTCAGC
TCGATCAAGTCGATGGTGGGGCATTCCCTGGGCGCCATAGGCGCGATCGAGGTGGCCGCC
TCCGCACTCGCCATCGAGCACGGAGTGGTGCCGCCGACGGCGAACCTCACCACACCGGAC
CCCGAGTGCGATCTCGACTATGTCCCGCGCGAGGCGCGTGAGCACCCCACCGACGTGGTG
CTCAGCGTCGGAAGCGGCTTCGGCGGCTTCCAGAGCGCGGTCGTACTGATCTCTCCGAGG
AGCAGGCGATGA
KS5..376
KS13..1128

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [5-252]  4.30000000000003e-55 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [262-376]  1.9e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-267]  2.1e-63 G3DSA:3.40.47.10 [273-416]  1e-55 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-421]  4.89996723796399e-70 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [162-178]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1