close all open/close all

CDS information : Bena_00100


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction8,133 / 9,362 / + [in whole cluster]
8,133 / 9,362 / + [in contig]
Location8133..9362 [in whole cluster]
8133..9362 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)BenB protein
Gene
Gene (GenBank)benB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

CLF3..359

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [BenB protein]
MTVITGLGVVAPTGVGLDDYWATTLAGKSGIDRIRRFDPSGYTAQLAGQVDDFEATDHVP
SKLLAQTDRMTHFAFAGANMALADAHVDLADFPEYERAVVTANSSGGVEYGQHELQKMWS
GGPMRVSAYMSVAWFYAATTGQLSIHHGLRGPCGLIATEQAGGLDALGHARRLLRRGARI
AVTGGTDAPLSPASMVAQLATGLLSSNPDPTAAYLPFDDRAAGYVPGEGGAIMIMEPAEH
ALRRGAERIYGEIAGYAATFDPAPGTGRGPTLGRAIRNALDDARIAPSEVDLVFADGSGT
PAMDRAEAEALTEVFGPRGVPVTVPKAATGRMYSGGGALDVATALLAMRDGVAPPTPHVT
ELASDCPLDLVRTEPRELPIRHALVCARGVGGFNAALVLRRGDLTTPEH
selected fasta
>polyketide synthase chain length factor subunit [BenB protein]
ATGACGGTGATCACCGGTCTGGGCGTGGTCGCCCCCACGGGCGTGGGCCTGGACGACTAC
TGGGCCACCACACTGGCGGGCAAGAGCGGCATCGACCGTATCCGCCGCTTCGACCCCTCC
GGCTACACCGCTCAACTCGCCGGTCAGGTCGACGACTTCGAGGCGACCGACCACGTCCCC
TCCAAGCTGCTCGCACAGACCGACCGGATGACGCACTTCGCGTTCGCCGGTGCGAACATG
GCGTTGGCGGACGCGCATGTCGACCTTGCCGACTTTCCCGAGTACGAGCGGGCCGTGGTC
ACCGCCAACTCCTCCGGGGGCGTCGAGTACGGGCAGCACGAACTGCAGAAGATGTGGAGT
GGCGGCCCCATGCGGGTGAGCGCCTACATGTCGGTGGCCTGGTTCTACGCGGCCACCACC
GGTCAGCTGTCCATCCATCACGGCCTGCGTGGCCCCTGCGGGCTGATAGCGACCGAACAG
GCCGGGGGACTCGATGCCCTCGGACACGCCCGGCGTCTGCTGCGGCGCGGCGCCCGCATC
GCCGTCACGGGTGGCACCGACGCGCCGCTCTCGCCGGCCAGCATGGTCGCGCAGTTGGCG
ACCGGGCTGCTCAGTTCGAACCCGGACCCGACGGCCGCCTACCTGCCGTTCGACGACCGT
GCGGCGGGCTACGTGCCGGGCGAGGGCGGCGCGATCATGATCATGGAACCGGCCGAGCAC
GCACTGCGGCGCGGTGCCGAGCGGATCTACGGAGAGATCGCCGGGTACGCGGCGACCTTC
GACCCCGCGCCGGGCACCGGACGGGGCCCGACACTCGGCCGGGCGATCCGTAACGCGCTC
GACGACGCCCGGATCGCCCCAAGCGAAGTCGACCTGGTCTTCGCGGACGGCTCCGGGACG
CCGGCCATGGACCGCGCGGAGGCCGAAGCGCTGACGGAGGTGTTCGGGCCGCGCGGTGTA
CCGGTCACCGTCCCGAAGGCGGCAACCGGGCGGATGTACTCCGGCGGTGGCGCCCTCGAT
GTCGCCACCGCTCTGTTGGCCATGCGCGACGGCGTGGCGCCGCCCACCCCGCATGTGACC
GAGCTCGCCTCGGACTGCCCGCTGGATCTTGTCCGTACGGAGCCGCGGGAGCTGCCGATC
CGTCATGCATTGGTCTGCGCCAGGGGAGTTGGCGGCTTCAACGCGGCTCTCGTACTGCGG
CGCGGTGACCTGACGACTCCGGAGCACTGA
CLF3..359
CLF7..1077

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-240]  1.2e-47 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [250-359]  1.69999999999999e-28 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-255]  4.5e-55 G3DSA:3.40.47.10 [268-401]  2.59999999999998e-43 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-246]  3.10001307370206e-57 SSF53901 [209-401]  1.20000117458134e-54 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-16]  0.578 Signal
Eukaryota   
TMHMM No significant hit