close all open/close all

CDS information : Bena_00110


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction9,436 / 9,696 / + [in whole cluster]
9,436 / 9,696 / + [in contig]
Location9436..9696 [in whole cluster]
9436..9696 [in contig]
TypeCDS
Length261 bp (86 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)BenC protein
Gene
Gene (GenBank)benC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q2MGC9
NITE
Fred_00100
PmId
[16895912] A dedicated phosphopantetheinyl transferase for the fredericamycin polyketide synthase from Streptomyces griseus. (J Biol Chem. , 2006)

close this sectionPKS/NRPS Module

ACP5..79

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [BenC protein]
MSTLSVEKLLEIMRATQGESADTSGLTEDVLDKPFTDLNVDSLAVLEVVTQIQDEFKLRI
PDSAMEGMETPRQVLDYVNERLEEAA
selected fasta
>polyketide synthase acyl carrier protein subunit [BenC protein]
GTGAGCACACTGAGCGTGGAAAAGCTGCTCGAAATCATGCGGGCGACCCAGGGCGAGTCC
GCGGACACGTCGGGCCTGACCGAGGACGTCCTCGACAAACCGTTCACCGACCTGAACGTT
GACTCGCTGGCCGTCCTTGAGGTCGTGACCCAGATCCAGGACGAGTTCAAGCTGCGCATA
CCGGACTCCGCCATGGAGGGCATGGAGACCCCTCGACAGGTGCTCGACTACGTCAACGAG
CGCCTGGAAGAGGCGGCCTGA
ACP5..79
ACP13..237

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003231 Acyl carrier protein (ACP) (Family)
 [40-77]  PD000887
PD000887   PD000887
IPR006162 Phosphopantetheine attachment site (PTM)
 [37-52]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [27-84]  3.2e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [30-78]  9.60000000000001e-10 PF00550
PF00550   PP-binding
 [5-79]  PS50075
PS50075   ACP_DOMAIN
 [1-86]  7.60000011115812e-13 SSF47336
SSF47336   ACP_like
SignalP No significant hit
TMHMM No significant hit