close all open/close all

CDS information : Bena_00120


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction9,698 / 10,537 / + [in whole cluster]
9,698 / 10,537 / + [in contig]
Location9698..10537 [in whole cluster]
9698..10537 [in contig]
TypeCDS
Length840 bp (279 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/hypothetical protein
Product (GenBank)BenH protein
Gene
Gene (GenBank)benH
EC number
Keyword
  • 1st and 2nd ring
  • unreduced polyketide
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
[8692863] Deciphering the mechanism for the assembly of aromatic polyketides by a bacterial polyketide synthase. (Proc Natl Acad Sci U S A. , 1996)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[18388203] Crystal structure and functional analysis of tetracenomycin ARO/CYC: implications for cyclization specificity of aromatic polyketides. (Proc Natl Acad Sci U S A. , 2008)

close this sectionSequence

selected fasta
>putative cyclase/hypothetical protein [BenH protein]
MAGRTDNSVVIDAPVQLVWDMTNDVSQWAVLFEEYAESEVLAVDGDTVRFRLTTQPDEDG
KQWSWVSERTRDLENRTVTARRLDNGLFEYMNIRWEYTEGPDGVRMRWIQEFSMKPSAPV
DDSGAEDHLNRQTVKEMARIKKLIEEAAARAGVDGGIPAEGKDSVRDATGNGDPGPVFRV
LLRAEIADGKEKEFEDAWREIGQVITGQPANLGQWLMRSHDEPGVYYIISDWTDEERFRA
FERSEEHVGHRSTLQPFRTKGSMVTTDVVAAMTKAGQTW
selected fasta
>putative cyclase/hypothetical protein [BenH protein]
ATGGCCGGCCGTACCGACAACTCCGTTGTCATCGACGCCCCCGTGCAACTGGTCTGGGAC
ATGACCAACGACGTTTCCCAGTGGGCTGTCCTGTTCGAGGAGTACGCCGAGTCGGAGGTG
CTCGCCGTCGATGGCGACACGGTCCGGTTCCGGCTCACGACCCAGCCGGACGAGGACGGG
AAGCAGTGGAGCTGGGTCTCCGAGCGGACTCGCGACCTCGAGAACCGTACAGTCACCGCA
CGCCGGCTCGACAACGGCTTGTTCGAGTACATGAACATCCGCTGGGAGTACACCGAGGGC
CCGGACGGCGTCCGTATGCGCTGGATCCAGGAGTTCTCCATGAAACCGTCCGCGCCCGTG
GACGACTCCGGCGCCGAAGATCATCTGAACCGGCAGACGGTCAAGGAAATGGCGCGCATC
AAGAAGCTGATCGAAGAGGCCGCCGCCCGGGCCGGCGTCGACGGCGGGATTCCGGCGGAG
GGGAAGGACAGCGTGAGGGACGCGACGGGGAACGGCGACCCCGGGCCGGTGTTCAGGGTG
CTGCTGCGAGCCGAGATCGCCGATGGCAAGGAGAAGGAGTTCGAGGACGCATGGCGGGAG
ATCGGTCAGGTCATCACCGGCCAGCCCGCCAACCTCGGCCAATGGCTCATGCGCAGCCAC
GATGAGCCCGGCGTCTACTACATCATCAGCGACTGGACCGACGAAGAGCGCTTCCGCGCG
TTCGAGCGCAGCGAGGAGCACGTCGGACACCGGAGCACGCTGCAGCCGTTCCGGACGAAG
GGCTCCATGGTGACCACTGACGTCGTGGCGGCGATGACGAAGGCAGGGCAGACGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [11-121]  7.90000000000001e-13 PF03364
PF03364   Polyketide_cyc
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [178-250]  1.5e-15 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [176-274]  1.39999892049878e-20 SSF54909
SSF54909   Dimer_A_B_barrel
IPR023393 START-like domain (Domain)
 [6-116]  5.20000000000001e-13 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit