close all open/close all

CDS information : Bena_00130


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction10,531 / 10,878 / + [in whole cluster]
10,531 / 10,878 / + [in contig]
Location10531..10878 [in whole cluster]
10531..10878 [in contig]
TypeCDS
Length348 bp (115 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)BenJ protein
Gene
Gene (GenBank)benJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [BenJ protein]
MVSAANERGLLRVTIYVRVRDEQDPDDVEKLIQAYHESSKALEGTPGMLRNELLRDVKEP
VRFAVLSEWEDRHAFLEWEEGVRHKGQTAPIREFADPTPSGRPFAVYEVVAAYSA
selected fasta
>hypothetical protein [BenJ protein]
GTGGTGAGCGCCGCGAACGAGCGGGGCCTGCTGCGCGTCACCATCTACGTCCGGGTGCGC
GACGAACAGGATCCGGACGACGTCGAGAAGTTGATTCAGGCGTACCACGAGTCCAGTAAG
GCGCTGGAGGGCACGCCGGGCATGCTTCGCAACGAACTGCTCCGCGACGTGAAGGAACCA
GTTCGTTTCGCCGTCCTGAGCGAGTGGGAGGACCGGCATGCATTCCTGGAATGGGAGGAG
GGCGTCCGGCACAAAGGGCAGACCGCGCCGATCCGCGAGTTCGCCGACCCGACGCCATCC
GGAAGGCCCTTCGCCGTTTACGAAGTGGTAGCGGCCTACTCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [20-85]  6.60000000000002e-11 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [14-114]  1.80000149287196e-15 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit