close all open/close all

CDS information : Bena_00140


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction11,178 / 13,148 / + [in whole cluster]
11,178 / 13,148 / + [in contig]
Location11178..13148 [in whole cluster]
11178..13148 [in contig]
TypeCDS
Length1,971 bp (656 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)BenR protein
Gene
Gene (GenBank)benR
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q54494
NITE
Nogl_00360
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[9349712] Characterization of Streptomyces nogalater genes encoding enzymes involved in glycosylation steps in nogalamycin biosynthesis. (Mol Gen Genet. , 1997)
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative transcriptional regulator [BenR protein]
MTDVPAVRLRVLGPLEVIGGGDRELTPSAPKLRQLVALLVVSGNRIVGIHEMMDELWGSS
PPASALATLQSYIYKIRKNVFEVLGDTGVSLHTKPNGYRLDVPAGVLDVHGFEELIDQGR
KALDGGDAETAAELLAGALAFWRGVPLANVDPGDQLGVQITRYQERRKHALELRLEAELQ
LGRHRELIGELKTLCSNHPLDEGMHSKLMIALYRSGRRHEALETYQTFRRGMIDELGLEP
SPMLARLHTAVLVAEPELHLDGESTLELALRPVQIVSEYIDAASGHTVAGNEDDGEWGEP
AGSRIAAAAGLPLGGPTQQVRSVPRPAQLPPDIADFTGRAKVLTRLESRLAECRDQHAPL
PVLWITGMPGVGKSALATRLAHRVRDRFPDGQLYVDLRGGGADPVHPRTVLHRFLAALGE
PRSALPDDIDEASELFRSRCASRSLLFLLDSAATTAQVRSLLPGNGDCAVIVTSLAHGLA
GSELVLLDPLCDDEAHQLLTSIIGPQRAGENPSAVDRIVELCGGLPLSLRAVGTRLSRLP
GWPLGQFAERLADPRRRLAESSLPGLDLRASYHAEFQQLDERDRLVMQLFAMRAGDPFTA
EDAAEQLGCDLVSAEGVLARLAERHLLQAAGTKEGLVGYSVHELVRVYTLQRLAGN
selected fasta
>putative transcriptional regulator [BenR protein]
ATGACTGACGTTCCTGCGGTGCGGCTTCGTGTGCTGGGGCCTCTGGAGGTAATCGGTGGC
GGAGATCGTGAATTGACGCCCAGCGCCCCGAAGCTGCGGCAACTGGTGGCGCTGTTGGTG
GTGTCCGGGAACCGGATCGTAGGCATACACGAGATGATGGATGAGTTATGGGGGAGCTCC
CCGCCTGCGAGTGCGCTTGCCACTCTCCAGTCGTACATCTACAAGATCCGGAAGAATGTC
TTCGAAGTGCTCGGGGACACCGGTGTCTCGTTGCACACCAAGCCGAACGGTTACCGGCTG
GATGTCCCGGCAGGTGTCCTCGACGTGCACGGCTTCGAGGAGCTGATCGACCAGGGACGG
AAGGCACTTGACGGCGGAGACGCCGAGACGGCCGCCGAACTTCTCGCGGGCGCCCTCGCC
TTCTGGCGTGGTGTCCCACTGGCCAACGTCGATCCCGGCGATCAGCTCGGCGTCCAGATC
ACGCGCTATCAGGAGCGCCGCAAGCATGCGTTGGAGCTGCGGCTTGAGGCCGAACTCCAG
CTCGGCCGGCACCGCGAGCTGATCGGCGAACTGAAGACGCTGTGCTCCAACCATCCCCTC
GACGAGGGTATGCACAGCAAACTCATGATCGCCCTGTACCGCTCCGGCCGACGGCACGAA
GCCTTGGAGACGTATCAGACCTTCCGGCGGGGCATGATCGACGAGCTGGGCCTGGAGCCC
TCGCCCATGCTGGCACGACTGCACACCGCCGTGCTGGTGGCCGAACCCGAACTGCATCTC
GACGGTGAGTCCACGCTCGAACTGGCACTGCGCCCGGTGCAGATCGTGTCGGAGTACATC
GATGCGGCGTCCGGGCACACCGTCGCCGGGAACGAGGATGACGGGGAGTGGGGGGAGCCT
GCCGGATCGCGGATCGCGGCCGCGGCCGGTTTGCCGCTGGGCGGTCCGACCCAGCAGGTC
CGGTCTGTCCCTCGTCCGGCTCAGCTGCCCCCCGACATAGCCGACTTCACCGGACGGGCG
AAGGTGCTCACCCGGCTGGAGAGCCGCCTCGCGGAGTGCCGTGACCAGCATGCCCCGCTG
CCAGTCCTGTGGATCACCGGCATGCCGGGAGTGGGCAAATCGGCCCTGGCCACGCGACTC
GCACACCGGGTGCGCGACCGGTTCCCCGACGGTCAGCTCTACGTGGACCTGCGCGGCGGC
GGTGCCGACCCGGTTCACCCGCGCACCGTGCTGCATCGCTTCCTCGCCGCGCTCGGCGAA
CCCCGCTCCGCTCTCCCCGACGACATAGACGAAGCCAGTGAGTTGTTCCGCAGCCGCTGT
GCCTCCCGGTCGTTGCTCTTTCTCCTCGACAGTGCCGCGACCACGGCCCAGGTCAGGTCG
TTGCTGCCGGGCAACGGCGACTGCGCGGTCATCGTCACCAGCCTCGCGCACGGACTTGCC
GGCTCCGAGCTGGTCCTCCTCGACCCCCTGTGTGACGACGAGGCCCACCAACTGCTCACC
TCCATCATCGGACCACAACGGGCGGGGGAGAACCCGTCGGCCGTCGACCGGATCGTCGAG
CTCTGCGGTGGACTTCCGCTCTCGCTGCGGGCGGTTGGCACCAGGCTGAGCCGACTGCCG
GGCTGGCCGCTCGGCCAGTTCGCCGAGCGGCTCGCCGACCCTCGCCGCCGTCTTGCCGAG
TCAAGCCTCCCCGGCCTCGACCTGCGCGCCTCGTACCACGCCGAGTTTCAGCAGCTGGAC
GAGCGAGACCGGCTGGTCATGCAGTTGTTCGCGATGCGCGCCGGGGATCCGTTCACCGCG
GAGGACGCCGCCGAGCAGCTCGGCTGCGACCTGGTGAGCGCCGAGGGCGTACTCGCCAGG
CTCGCCGAGCGGCATCTGCTGCAGGCGGCGGGAACCAAGGAGGGCCTGGTGGGCTATTCC
GTCCATGAACTGGTGAGGGTCTACACGCTGCAACGGCTGGCGGGCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [362-377]  1.40000045763982e-08 PR00364 [439-453]  1.40000045763982e-08 PR00364 [522-536]  1.40000045763982e-08 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [22-100]  3.30000164480624e-06 SM00862
SM00862   Trans_reg_C
 [26-100]  1.6e-09 PF00486
PF00486   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [344-536]  2.4e-10 PF00931
PF00931   NB-ARC
IPR005158 Bacterial transcriptional activator domain (Domain)
 [107-252]  1.3000049540733e-56 SM01043
SM01043   BTAD
 [107-252]  4.30000000000003e-47 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [113-227]  5.3e-05 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [30-103]  0.00013 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [6-101]  6.00000361638163e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit