close all open/close all

CDS information : Bena_00150


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction14,041 / 13,292 / - [in whole cluster]
14,041 / 13,292 / - [in contig]
Locationcomplement(13292..14041) [in whole cluster]
complement(13292..14041) [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productketoreductase
Product (GenBank)BenL protein
Gene
Gene (GenBank)benL
EC number
Keyword
  • pentangular
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
[17625850] Biosynthesis of pentangular polyphenols: deductions from the benastatin and griseorhodin pathways. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>ketoreductase [BenL protein]
MNLPLTGRHALVTGGSRGIGKAIVLALARAGADVLACHQNPSAQADQLALELKRTEGDHH
LLQADITDPADVDRLVNEAKTRYGSLEIVVHNAGVISHVPLPQLELAEWHRVLDTSLTAA
FAVVQKTLPLYGERASVILIGSRSAARGIALRSHYTAAKAGLEGFARSAAKELGGRGVRV
NVIAPGVIDSDDAKAIPAEQRAQLVARYGDKTALGRLGEPDEIAGAAVFLAGDLSSYVTG
QTINVDGGI
selected fasta
>ketoreductase [BenL protein]
GTGAATCTCCCCCTCACCGGCAGGCACGCGCTCGTCACAGGCGGCAGTCGAGGCATTGGA
AAGGCCATCGTGCTCGCCCTCGCCCGGGCAGGAGCCGATGTTCTGGCCTGCCACCAGAAC
CCGAGTGCGCAAGCGGACCAGTTGGCCCTGGAGCTGAAAAGGACGGAAGGCGACCACCAC
CTGCTGCAGGCCGACATCACCGACCCGGCCGACGTCGATCGGCTGGTGAATGAGGCGAAG
ACCAGGTACGGCTCGCTGGAGATCGTCGTGCACAACGCCGGCGTGATCAGCCATGTCCCG
CTGCCGCAGCTGGAGTTGGCGGAATGGCACAGGGTGCTGGACACCAGCCTGACCGCGGCC
TTCGCGGTGGTGCAAAAGACGCTTCCGCTGTACGGGGAACGGGCCTCCGTCATATTGATC
GGCTCCCGGTCCGCGGCTCGCGGTATCGCTCTGCGGAGTCACTACACGGCGGCCAAGGCG
GGCCTGGAAGGCTTCGCCCGCTCGGCCGCGAAGGAGCTGGGCGGACGCGGGGTGCGCGTC
AACGTGATCGCACCCGGAGTGATCGACAGCGACGACGCCAAGGCGATCCCGGCCGAACAA
CGCGCCCAACTGGTCGCCCGTTACGGCGACAAGACCGCGCTCGGGCGGCTCGGCGAGCCG
GATGAGATCGCCGGCGCCGCGGTCTTCCTCGCCGGCGACCTCTCCTCATACGTGACAGGC
CAGACGATCAACGTGGACGGGGGGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [84-95]  3.49999851148921e-07 PR00080 [155-174]  3.49999851148921e-07 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  1.20000117458134e-36 PR00081 [84-95]  1.20000117458134e-36 PR00081 [155-174]  1.20000117458134e-36 PR00081 [176-193]  1.20000117458134e-36 PR00081 [213-233]  1.20000117458134e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-248]  1.29999999999998e-78 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-32]  0.408 Signal
Bacteria, Gram-positive   
TMHMM No significant hit