close all open/close all

CDS information : Bena_00160


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction15,189 / 14,179 / - [in whole cluster]
15,189 / 14,179 / - [in contig]
Locationcomplement(14179..15189) [in whole cluster]
complement(14179..15189) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productbeta-ketoacyl synthase
Product (GenBank)BenQ protein
Gene
Gene (GenBank)benQ
EC number
Keyword
  • hexanoate
Note
Note (GenBank)
Reference
ACC
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
[19047004] Ketosynthase III as a gateway to engineering the biosynthesis of antitumoral benastatin derivatives. (J Biotechnol. , 2009)
Related Reference
ACC
Q9F6D4
NITE
R1128_00080
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

KS13..335

close this sectionSequence

selected fasta
>beta-ketoacyl synthase [BenQ protein]
MSQLSLSQAAPAGGSRIRGVGAYRPARVVTNEEIAPRIGVAPEWIARRSGIHTRRFAGPD
EPLAMMAATASEKALAAAGLSADEVDCVLVATISHLLQMPALAVDVAHRLGAAPTAAFDL
SAACAGFCHGVAIADSMVRSGTAHNVLLVGADRMTDVVDADDPATAFLFADGAGAVVIGP
SETPGIGPVAWGSDGERMDAITMTGHWTPSLRTNPELPWPYLCMTGWKVFRWATETMGQA
ARDAIERAGVTSEELSAFIPHQANGLITDALAKDIGLTADTAIARDITDSGNTSGASIPM
AMERLLASGQARSGEAALLIGFGSGLVHAGQVVLLP
selected fasta
>beta-ketoacyl synthase [BenQ protein]
ATGTCTCAGTTGTCCTTGTCTCAGGCCGCTCCGGCCGGTGGCAGCCGTATCCGCGGCGTC
GGGGCGTACCGGCCCGCGCGCGTCGTCACCAACGAGGAGATCGCCCCTCGGATCGGGGTG
GCTCCCGAGTGGATCGCCCGCCGGTCGGGCATCCACACCCGGCGGTTCGCCGGACCGGAC
GAGCCGCTGGCGATGATGGCGGCTACGGCCTCGGAAAAGGCCCTGGCCGCAGCCGGTCTG
TCGGCCGACGAGGTGGACTGCGTCCTGGTCGCGACGATCAGCCATCTCCTTCAGATGCCC
GCGCTGGCGGTGGACGTGGCCCATCGGCTCGGCGCCGCGCCCACCGCCGCATTCGACCTG
TCGGCGGCCTGTGCCGGGTTCTGCCACGGCGTTGCGATCGCGGACAGCATGGTCCGCTCG
GGCACCGCCCACAACGTGCTGCTGGTCGGGGCGGACCGCATGACGGATGTGGTGGATGCC
GACGATCCGGCTACCGCCTTCCTCTTCGCGGATGGAGCGGGCGCCGTCGTCATCGGCCCG
TCCGAGACACCAGGTATCGGCCCGGTGGCCTGGGGCTCGGACGGCGAGCGGATGGACGCG
ATCACCATGACCGGTCACTGGACGCCGAGTCTGCGCACCAATCCCGAACTCCCGTGGCCC
TACCTGTGCATGACGGGCTGGAAGGTCTTCCGGTGGGCCACCGAGACCATGGGGCAGGCG
GCCCGTGACGCCATCGAGCGAGCCGGTGTGACGTCCGAGGAACTGTCCGCCTTCATCCCG
CACCAGGCGAACGGACTCATCACCGACGCCCTGGCCAAGGACATCGGCCTGACCGCTGAC
ACGGCCATCGCCCGGGACATCACCGACAGCGGCAACACCTCCGGCGCCTCGATCCCGATG
GCGATGGAGCGCCTGCTCGCTTCAGGTCAGGCCCGGTCCGGTGAGGCAGCCCTGCTCATC
GGTTTCGGCTCCGGGCTGGTGCACGCCGGGCAGGTCGTCCTGCTCCCCTAG
KS13..335
KS37..1005

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [16-333]  4.30000000000003e-97 TIGR00747
TIGR00747   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [245-333]  3.3e-23 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [118-195]  3.8e-26 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [15-173]  1.99999999999999e-55 G3DSA:3.40.47.10 [174-333]  7.00000000000005e-39 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [5-335]  6.99997659850661e-48 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit