close all open/close all
Bena_00160 Bena_00160   last last

CDS information : Bena_00170


close this sectionLocation

Organism
StrainA2991200
Entry nameBenastatin
Contig
Start / Stop / Direction17,480 / 15,351 / - [in whole cluster]
17,480 / 15,351 / - [in contig]
Locationcomplement(15351..17480) [in whole cluster]
complement(15351..17480) [in contig]
TypeCDS
Length2,130 bp (709 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)
GenebenX
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[17439117] Molecular analysis of the benastatin biosynthetic pathway and genetic engineering of altered fatty acid-polyketide hybrids. (J Am Chem Soc. , 2007)
Related Reference
ACC
P96687
PmId
[15941986] The Bacillus subtilis YdfHI two-component system regulates the transcription of ydfJ, a member of the RND superfamily. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein(fragment)
MASQAAGPAYANVFSVPGTEAEKAQDLVKSAFPDSAGDMDTVVWHVADGTVRDASVRERL
SATLDEIDRLDTVGSVTSPYSQAGTTQISQDGRTAYARITYHKTAEELSVDEAERVVDTA
TAARADGIEVEVSGPVAEKTEEGQAGNIAEFVGLLAAAIVLYLAFGSLLAMLLPLISALF
SVGTGVMTIKLLSHGADVPELAATLSTLIGLGVGIDYALFIITRHRQGLKAGLGPEEAAV
RALNTSGRAVLFAGATVCIALLGLLALRLQFLTGVAIATTTMVVLTMGTSVTFMPALLSL
CGLRVLSRRERRRLAEEGSSQEEPRGLAVRWAAFVQRRPGGLLTAAVVVLAVLTIPFFSL
RLGISDQGNRPASNTTRQAYDMLEDGFGPGFNGPLQLVAELDGQSDKEALRQLADTVRND
ADVASVVALPAQPDATTAVVQVIPKTAPQDEATSELIARLRDTTIPAAERGTTMQVHVGG
QTATFDDFATVMLGKLPWFVLIVVALGFLLLLVAFRSLVIPVTAAVMNLLAAAASFGVLV
ALFQWGWLSGPLGVGGAGPVEAFLPAVMLAVLFGLSMDYQVFLVSRMHEEWVHSHDNPKA
VTVGLTNTSRVINAAAVIMICVFSAFVFRDERIISEFGVGLAAAVALDAFVIRTMLVPAV
MRVLGTANWWLPGWLDKRLPHLAVEPTDEPAPPVSPPPAPAKAPDVRAN
selected fasta
>hypothetical protein(fragment)
GTGGCCAGCCAGGCCGCAGGCCCCGCTTACGCGAACGTCTTCTCCGTCCCCGGCACCGAA
GCGGAGAAGGCACAGGATCTTGTCAAGTCCGCGTTCCCGGACAGCGCGGGCGACATGGAC
ACCGTCGTCTGGCACGTGGCCGACGGGACCGTCCGGGACGCCTCGGTACGCGAACGGCTG
TCCGCGACACTCGATGAGATCGACCGGCTCGACACGGTCGGCTCGGTGACCAGTCCGTAC
TCGCAGGCCGGAACCACTCAGATCAGCCAGGACGGCCGTACCGCCTACGCCAGGATCACG
TACCACAAGACGGCCGAGGAGCTGTCGGTGGACGAGGCCGAGCGCGTCGTCGACACCGCG
ACTGCTGCCCGTGCCGATGGGATCGAGGTCGAGGTCTCGGGGCCCGTAGCGGAGAAGACC
GAGGAGGGGCAGGCCGGCAACATCGCCGAGTTCGTGGGCCTGCTGGCCGCCGCGATCGTG
CTCTATCTCGCCTTCGGGTCGCTGTTGGCGATGCTGTTGCCACTGATCAGCGCGCTGTTC
AGCGTCGGCACCGGGGTAATGACGATCAAGCTTCTGTCGCACGGCGCCGATGTACCGGAA
CTGGCCGCCACCCTGTCGACGCTGATCGGCCTCGGCGTAGGAATCGACTACGCGCTGTTC
ATCATCACGCGCCACCGGCAGGGACTCAAGGCGGGCCTCGGTCCGGAAGAGGCTGCCGTC
CGGGCTCTCAACACGTCGGGCCGCGCCGTTCTCTTCGCCGGTGCCACGGTGTGCATCGCG
CTCCTCGGCCTGCTGGCACTGCGGCTTCAGTTCCTCACGGGCGTCGCCATCGCCACCACC
ACGATGGTGGTACTCACCATGGGCACGTCGGTGACCTTCATGCCGGCGCTGCTCAGCCTG
TGCGGCCTGCGGGTGCTCAGTCGCCGGGAGCGGCGGCGACTGGCCGAAGAGGGCTCGAGC
CAGGAGGAACCGCGCGGACTCGCTGTGCGGTGGGCGGCTTTCGTCCAGCGCCGTCCCGGC
GGGCTCCTGACGGCCGCCGTAGTCGTGCTGGCCGTTCTGACCATCCCGTTCTTCTCGCTC
CGGCTCGGCATCTCCGACCAGGGCAACCGTCCGGCGTCGAACACCACTCGCCAGGCGTAC
GACATGCTGGAGGACGGCTTCGGGCCGGGCTTCAACGGACCGCTGCAACTGGTCGCCGAA
CTCGACGGCCAAAGCGATAAGGAAGCTCTACGGCAACTCGCCGACACCGTACGGAACGAC
GCGGACGTGGCCTCGGTGGTAGCCCTGCCCGCGCAGCCGGACGCCACGACGGCAGTGGTG
CAGGTGATCCCGAAGACCGCCCCCCAGGACGAGGCGACATCGGAACTCATCGCACGATTG
CGCGACACGACCATTCCGGCCGCCGAGCGCGGCACCACGATGCAGGTTCACGTCGGGGGA
CAGACCGCGACGTTCGACGACTTCGCCACCGTCATGCTCGGCAAGCTGCCGTGGTTCGTG
CTGATCGTGGTGGCCCTCGGCTTCCTTCTGCTCCTCGTGGCCTTCCGCAGTCTGGTGATC
CCGGTAACGGCTGCGGTGATGAACCTGCTCGCCGCGGCGGCATCGTTCGGTGTGCTGGTG
GCGCTCTTCCAGTGGGGCTGGCTCTCAGGTCCACTCGGGGTCGGTGGGGCCGGGCCGGTC
GAGGCGTTCCTGCCGGCGGTCATGCTGGCGGTGTTGTTCGGACTGTCGATGGACTACCAG
GTGTTCCTGGTCAGCCGGATGCACGAGGAGTGGGTGCACTCCCACGACAACCCCAAGGCG
GTGACCGTGGGCCTGACGAACACGAGCCGGGTCATCAACGCGGCCGCGGTCATCATGATC
TGCGTGTTCTCGGCGTTCGTGTTCCGCGACGAGCGGATCATCTCCGAGTTCGGCGTGGGC
CTGGCAGCAGCCGTGGCACTGGACGCGTTCGTCATCCGCACCATGCTGGTGCCCGCCGTC
ATGCGGGTGCTGGGCACTGCCAACTGGTGGCTGCCCGGCTGGCTCGACAAGCGGCTCCCC
CACCTGGCGGTCGAACCGACGGATGAACCCGCACCCCCGGTGTCCCCGCCTCCCGCTCCG
GCGAAGGCCCCCGACGTGCGGGCGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004869 Membrane transport protein, MMPL type (Domain)
 [15-340]  4.6e-60 PF03176 [404-670]  7.5e-34 PF03176
PF03176   MMPL
SignalP No significant hit
TMHMM
 [159-181]  Transmembrane (i-o) [201-223]  Transmembrane (o-i) [249-271]  Transmembrane (i-o) [281-303]  Transmembrane (o-i) [340-362]  Transmembrane (i-o) [498-520]  Transmembrane (o-i) [525-547]  Transmembrane (i-o) [562-584]  Transmembrane (o-i) [611-628]  Transmembrane (i-o) [633-652]  Transmembrane (o-i)
Transmembrane 10   
Bena_00160 Bena_00160   last last