close all open/close all
first first   Borre_00020 Borre_00020

CDS information : Borre_00010


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction2 / 313 / + [in whole cluster]
2 / 313 / + [in contig]
Location2..313 [in whole cluster]
2..313 [in contig]
TypeCDS
Length312 bp (103 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB1
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [hypothetical protein]
MPRGIAVDVLRAGDRWPHSAAPRHRGLLNAWWGAWVWATVFDRYASRTYDDAQDVDAIHD
AAGLVMAGAGFDILAAVLAILFVRRLTAAQHAKALAGPTPPTH
selected fasta
>hypothetical protein(fragment) [hypothetical protein]
ATCCCGCGCGGCATCGCCGTCGACGTGCTGCGGGCCGGCGACCGCTGGCCCCACAGCGCG
GCACCGCGCCACCGGGGACTCCTCAACGCCTGGTGGGGCGCCTGGGTCTGGGCCACGGTC
TTCGACCGCTACGCGTCGAGGACCTACGACGACGCCCAGGACGTCGACGCGATCCACGAC
GCGGCGGGACTGGTCATGGCCGGTGCCGGATTCGACATCCTCGCCGCCGTGCTCGCGATC
CTCTTCGTGCGCCGGCTGACCGCCGCACAGCACGCGAAGGCCCTCGCGGGGCCCACCCCG
CCGACGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025565 Domain of unknown function DUF4328 (Domain)
 [1-90]  5.7e-15 PF14219
PF14219   DUF4328
SignalP
 [1-38]  0.428 Signal
Eukaryota   
TMHMM
 [61-83]  Transmembrane (o-i)
Transmembrane 1   
first first   Borre_00020 Borre_00020