close all open/close all

CDS information : Borre_00020


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction501 / 3,107 / + [in whole cluster]
501 / 3,107 / + [in contig]
Location501..3107 [in whole cluster]
501..3107 [in contig]
TypeCDS
Length2,607 bp (868 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB2
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MEAFLLLAAESVLLRRDQSVYVTPGSEPDGPPRAALRRLEAELLGRGHAVSAPLHAVLAS
LDSEELAAAHVRLVGLVDDLLGSDRTHTPLFRRFPRTVPRDTEALYVDRVFAFLLQQPEQ
PCVLCGEARTVLPVSPCAHLVCRLCWDGSDYAGCPLCHRRIDGDDPFLRPVRAVGAARAT
VPGPLRLLRLGTDMTADATTAVDALLARRTPLSPQDRDDLLTLLPLTPAGRGDLPQDIPV
RETKALVLGALVRRAPSRPALRRLLAERLTTATDVLRLLAVLSGGDAGLVTPARFTNVPR
SLRRDLLAVLDGLPAPYLVEDMLRHPTAWKRAAEVLHPFEGHTRHPRAALATAVLRATPL
DPDTAFGAALLTTAAAHPDAVRPDGTRVRPATWAGRLEQAMAEGDAARAAALAGERPGEL
VRRLDVLLRLHTDEALVPELEKALRHGLPKVGPGPLLSALGALRTRTEDRTGTRRVFFPR
GDVTRALSVPERRPALPAGPVSEVVALLEGELLRRFAAGRPYELSVLDAGLTDLTVPFTE
RTAAKALVTVGRGSVQALPEGSVLRLFLHWTEPRGNRTDLDLSVAFFDAEWTFTGLCDYT
NLVHGPDAAIHSGDLTSAPAPRGATEYVDLDLERLARRGDTYAVPLVFSYNNVPFEELPD
AFAGFMALPAEGPRDATYDPRTVRQRFDLAGDSKVCLPMIVDLARRRALWTDTHLPSAGG
FQSIGSHGGGELAAVAGDLWQQFTSGGRATLWDLAVLRAAALSPEVAVVSREPEPAVLRY
RRRAAESEAAFAVRVASHKDAEERLAHTDPDSAAAGLAAGRRVFLATVHGDVRPPGASGT
SYRLFPGAGDASPTLTRVTAGDLLAELG
selected fasta
>hypothetical protein [hypothetical protein]
GTGGAGGCTTTCCTGTTGCTCGCCGCCGAGTCCGTACTGCTGCGCCGTGACCAGAGCGTC
TACGTGACCCCGGGGTCCGAGCCGGACGGTCCGCCGAGGGCCGCACTGCGCCGGCTCGAG
GCCGAACTGCTCGGCCGCGGCCACGCCGTCTCCGCGCCGCTGCACGCGGTCCTCGCCTCC
TTGGACTCCGAGGAACTGGCGGCCGCCCACGTACGCCTCGTCGGACTCGTCGACGACCTG
CTCGGCTCCGACCGCACCCACACCCCGCTCTTCCGCCGCTTCCCGCGCACCGTGCCGCGC
GACACCGAGGCGCTGTACGTGGACCGCGTCTTCGCCTTCCTGCTGCAGCAGCCCGAGCAG
CCCTGCGTGCTGTGCGGCGAGGCGCGCACCGTCCTGCCCGTGTCACCCTGCGCGCACCTG
GTCTGCCGGCTGTGCTGGGACGGCTCCGACTACGCGGGATGCCCGCTGTGCCACCGCAGG
ATCGACGGGGACGACCCCTTCCTGCGTCCGGTCCGTGCCGTCGGCGCCGCCAGGGCGACC
GTACCGGGCCCGCTGCGACTGCTGCGCCTGGGCACCGACATGACCGCCGACGCCACCACG
GCGGTGGACGCCCTGCTGGCCCGCCGCACCCCGCTCTCCCCGCAGGACCGGGACGACCTG
CTCACCCTGTTGCCGCTCACACCGGCCGGCCGGGGCGACCTGCCGCAGGACATCCCGGTC
CGCGAGACCAAGGCGCTGGTCCTGGGCGCGCTGGTGCGCCGGGCACCGTCGCGGCCGGCC
CTGCGGAGGCTGCTCGCCGAGCGGCTCACCACCGCCACCGACGTGCTGCGGCTGCTCGCC
GTGCTCTCGGGCGGCGACGCCGGGCTGGTGACACCGGCACGGTTCACGAACGTTCCCCGT
TCCCTGCGGCGTGACCTGCTCGCCGTCCTCGACGGACTGCCGGCGCCGTACCTGGTCGAG
GACATGCTGCGGCACCCCACGGCGTGGAAGCGGGCCGCGGAGGTGCTGCACCCCTTCGAG
GGGCACACCCGGCACCCGCGCGCCGCGCTCGCCACCGCCGTGCTGCGCGCCACACCGTTG
GACCCGGACACCGCCTTCGGCGCCGCCCTGCTGACCACGGCCGCCGCGCACCCGGACGCC
GTGCGCCCGGACGGCACCCGAGTCCGCCCGGCCACCTGGGCGGGACGGCTGGAGCAGGCG
ATGGCCGAGGGGGACGCCGCTCGGGCCGCGGCCCTCGCCGGGGAGCGGCCCGGCGAACTG
GTGCGCCGCCTGGACGTGTTGCTGCGCCTGCACACCGACGAGGCGCTCGTGCCGGAGCTG
GAGAAGGCCCTGCGGCACGGGCTGCCGAAGGTGGGCCCGGGCCCGCTGCTGTCGGCGCTC
GGGGCGCTGCGGACACGCACCGAGGACCGCACCGGGACCCGGCGCGTGTTCTTCCCGCGG
GGCGACGTCACCCGGGCCCTGTCCGTCCCCGAGCGGCGCCCCGCCCTGCCCGCCGGGCCG
GTGTCCGAGGTGGTCGCCCTGCTGGAGGGGGAACTGCTGCGCCGGTTCGCCGCCGGGCGG
CCCTACGAGCTGTCGGTGCTGGACGCCGGACTGACCGACCTCACCGTGCCGTTCACCGAG
CGGACCGCCGCCAAGGCCCTGGTGACCGTGGGCCGCGGCAGCGTCCAGGCACTCCCCGAG
GGCTCCGTGCTCCGACTGTTCCTGCACTGGACGGAACCCCGGGGCAACCGCACCGACCTG
GACCTGTCCGTCGCCTTCTTCGACGCCGAGTGGACGTTCACCGGCCTGTGCGACTACACG
AACCTGGTGCACGGTCCGGACGCGGCGATCCACTCCGGCGACCTCACGTCGGCCCCGGCG
CCGCGCGGCGCCACCGAGTACGTGGACCTCGACCTGGAGCGGCTGGCGCGGCGGGGAGAC
ACCTACGCCGTCCCGCTGGTGTTCAGCTACAACAACGTCCCGTTCGAGGAACTGCCGGAC
GCCTTCGCCGGGTTCATGGCGCTGCCCGCGGAAGGCCCGCGCGACGCGACCTACGACCCG
CGCACCGTGCGGCAGCGCTTCGACCTCGCGGGCGACTCCAAGGTGTGCCTGCCGATGATC
GTGGACCTGGCCCGCCGGCGGGCGTTGTGGACCGACACCCACCTGCCGTCCGCGGGCGGC
TTCCAGAGCATCGGTTCGCACGGCGGCGGTGAGCTGGCCGCGGTGGCCGGTGACCTCTGG
CAGCAGTTCACCTCGGGCGGCCGGGCGACCCTGTGGGACCTCGCCGTCCTGCGGGCGGCC
GCCCTCTCGCCGGAGGTGGCGGTGGTGTCCCGGGAGCCGGAGCCCGCGGTGCTGCGTTAC
CGGCGGCGGGCGGCCGAGAGCGAGGCCGCGTTCGCCGTCCGAGTCGCGTCCCACAAGGAC
GCCGAGGAACGGCTGGCGCACACCGACCCCGACTCGGCCGCGGCCGGGCTCGCCGCCGGC
CGGCGGGTCTTCCTCGCGACGGTCCACGGTGACGTCCGGCCGCCGGGGGCGTCGGGCACG
TCCTACCGGCTCTTCCCCGGGGCCGGGGACGCCTCACCGACCCTGACCCGCGTGACCGCC
GGGGACCTGCTCGCCGAGCTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001841 Zinc finger, RING-type (Domain)
 [122-157]  0.000159999977185866 SM00184
SM00184   RING
 [122-158]  PS50089
PS50089   ZF_RING_2
IPR013083 Zinc finger, RING/FYVE/PHD-type (Domain)
 [119-164]  2.8e-05 G3DSA:3.30.40.10
G3DSA:3.30.40.10   Znf_RING/FYVE/PHD
SignalP
 [1-19]  0.515 Signal
Eukaryota   
TMHMM No significant hit