close all open/close all

CDS information : Borre_00040


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction4,924 / 3,935 / - [in whole cluster]
4,924 / 3,935 / - [in contig]
Locationcomplement(3935..4924) [in whole cluster]
complement(3935..4924) [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB4
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [hypothetical protein]
MTARAHSVGILVFDGMKMLDLSGPAEVFAEANRFGARYRLGVVSPDGAPVRSSIGLLVPA
EADARSAGPPDTLVVVGGDALPGSPVDPRLIDAAKALAARAGRVASVCTGAFVLGAAGLL
EGRRATTHWQHTTALARRCPSTRVEPDAIFVKDGATYTSAGVTAGIDLALALLEEDHGPD
LARRVARSLVVYLQRAGGQSQFSASLRGPAPRTPVLRQVQDAVQADPAADHSLAALAARV
RVSPRHLTRMFRAELDVTPVKYVELIRFDIAKALLDSGHNATEAAALSGFPSYESLRRAF
ARHLGLSPTRYRQRFATTVPDAGPRPDGG
selected fasta
>putative AraC family transcriptional regulator [hypothetical protein]
ATGACGGCGAGAGCGCACAGCGTGGGCATCCTGGTCTTCGACGGCATGAAGATGCTCGAC
CTGTCGGGGCCGGCGGAGGTCTTCGCGGAGGCCAACCGGTTCGGGGCCCGGTACCGGCTC
GGCGTCGTCTCCCCGGACGGGGCGCCGGTGCGTTCGTCCATCGGCCTGCTGGTCCCGGCC
GAGGCGGACGCGCGTTCCGCCGGCCCGCCGGACACGCTCGTCGTCGTCGGCGGTGACGCG
CTGCCCGGCTCGCCCGTCGACCCACGGCTCATCGACGCCGCGAAGGCGCTGGCGGCCCGG
GCCGGACGCGTCGCCTCGGTGTGCACCGGCGCCTTCGTGCTGGGTGCCGCGGGTCTGCTG
GAGGGCAGACGGGCGACGACGCACTGGCAGCACACCACCGCGCTGGCCCGCCGCTGTCCG
TCGACACGCGTGGAGCCCGACGCGATCTTCGTCAAGGACGGGGCGACCTACACGTCCGCC
GGCGTGACGGCGGGCATCGACCTGGCCCTCGCGCTGCTGGAGGAGGACCACGGGCCCGAT
CTCGCCCGCAGGGTCGCGCGCTCGCTGGTGGTGTACCTGCAGCGGGCCGGCGGCCAGTCG
CAGTTCTCCGCCTCGTTGCGGGGCCCGGCGCCGCGGACGCCCGTGCTGCGGCAGGTCCAG
GACGCCGTACAGGCCGATCCGGCCGCCGACCACAGTCTGGCGGCGTTGGCGGCGCGCGTG
CGGGTCAGCCCCCGGCATCTGACCCGGATGTTCCGGGCCGAGCTGGACGTCACGCCCGTG
AAGTACGTGGAGCTGATCCGTTTCGACATCGCCAAGGCGCTGCTCGACTCCGGGCACAAC
GCCACCGAGGCCGCCGCGCTGTCGGGTTTCCCCAGCTACGAGAGCCTGCGCCGGGCCTTC
GCCCGTCATCTGGGGCTGTCGCCCACCCGCTACCGGCAGCGCTTCGCCACCACCGTGCCG
GACGCCGGCCCGCGCCCGGACGGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [212-263]  7.49999605851445e-10 SSF46689 [266-315]  1.09999909120787e-09 SSF46689
SSF46689   Homeodomain_like
 [219-267]  8.00000000000001e-19 G3DSA:1.10.10.60 [271-316]  3.60000000000001e-13 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [217-314]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [230-312]  2.800005042611e-21 SM00342
SM00342   HTH_ARAC
IPR025628 DJ-1 domain, InhA-type (Domain)
 [11-174]  1.09999999999999e-40 PF13278
PF13278   DUF4066
SignalP
 [1-29]  0.199 Signal
Bacteria, Gram-positive   
TMHMM No significant hit