close all open/close all

CDS information : Borre_00050


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction5,123 / 5,953 / + [in whole cluster]
5,123 / 5,953 / + [in contig]
Location5123..5953 [in whole cluster]
5123..5953 [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative non-heme haloperoxidase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number1.11.1.-
Keyword
Note
Note (GenBank)
  • ORFB5
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
P49323
PmId
[8157602] Chloroperoxidase from Streptomyces lividans: isolation and characterization of the enzyme and the corresponding gene. (J Bacteriol. , 1994)
[9642069] Structural investigation of the cofactor-free chloroperoxidases. (J Mol Biol. , 1998)

close this sectionSequence

selected fasta
>putative non-heme haloperoxidase [hypothetical protein]
MGTVTTSDGTSIFYKDWGPRDAPPIVFHHGWPLTADDWDNQMLFFLSHGYRVIAHDRRGH
GRSGQPSTGHEMDTYAADVAALTEALDLRDAVHIGHSTGGGEVARYVARAEPGRVAKAVL
VGAVPPVMVKSDANPGGTPIEVFDGFRTALAANRAQFYIDVPSGPFYGFNREGAKVSQGL
IDNWWRQGMSGAANAHYECIKAFSETDFTEDLKAIDVPVLVAHGTDDQVVPYADSAPLSV
KLLKNGTLKSYEGLPHGMLSTHPEVVNPDLLDFVRS
selected fasta
>putative non-heme haloperoxidase [hypothetical protein]
ATGGGTACGGTCACCACCTCCGACGGCACGAGCATCTTCTACAAGGACTGGGGCCCGCGC
GACGCCCCGCCGATCGTCTTCCACCACGGCTGGCCGCTCACCGCGGACGACTGGGACAAC
CAGATGCTGTTCTTCCTCTCGCACGGCTACCGTGTGATCGCCCACGACCGGCGCGGCCAC
GGCCGCTCGGGCCAGCCCTCGACGGGCCACGAGATGGACACCTACGCCGCCGACGTCGCG
GCGCTGACCGAAGCGCTCGACCTGCGGGACGCCGTCCACATCGGGCATTCGACCGGCGGC
GGCGAGGTCGCGCGCTATGTGGCGCGCGCCGAACCGGGCCGGGTCGCCAAGGCCGTGCTG
GTCGGCGCCGTGCCGCCGGTGATGGTCAAGTCCGACGCCAACCCCGGCGGCACCCCGATC
GAGGTCTTCGACGGGTTCCGCACGGCCCTGGCCGCCAACCGGGCCCAGTTCTACATCGAC
GTGCCCTCCGGCCCCTTCTACGGATTCAACCGGGAGGGCGCGAAGGTCTCCCAGGGCCTG
ATCGACAACTGGTGGCGGCAGGGCATGTCGGGCGCGGCCAACGCCCACTACGAGTGCATC
AAGGCGTTCTCCGAGACCGACTTCACCGAGGACCTCAAGGCCATCGACGTGCCGGTGCTG
GTCGCGCACGGCACCGACGACCAGGTCGTGCCCTACGCGGACTCGGCGCCGCTGTCGGTG
AAGCTCCTGAAGAACGGCACCCTCAAGTCGTACGAAGGGCTCCCGCACGGCATGCTCTCC
ACCCACCCCGAGGTGGTCAACCCCGACCTCCTGGACTTCGTGAGGTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [49-64]  1e-08 PR00111 [93-106]  1e-08 PR00111 [219-233]  1e-08 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [29-47]  6.20000124972815e-06 PR00412 [49-64]  6.20000124972815e-06 PR00412 [251-273]  6.20000124972815e-06 PR00412
PR00412   EPOXHYDRLASE
SignalP
 [1-35]  0.193 Signal
Bacteria, Gram-negative   
TMHMM No significant hit