close all open/close all

CDS information : Borre_00060


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction6,518 / 5,961 / - [in whole cluster]
6,518 / 5,961 / - [in contig]
Locationcomplement(5961..6518) [in whole cluster]
complement(5961..6518) [in contig]
TypeCDS
Length558 bp (185 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB6
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MGVMIGPAGRERDEGDHVTQQAPVATDERRVFVDKQTPGAYKAFVAAAESVREAAAAAGL
DRLLVELVNIRVSQLNACAYCLSLHTRAALRAGETTQRLAVLPAWRDTELFTARERAALA
LAEATTRPADAAAQSAAYAQARGVLSDDEVSAVIWVAISINAFNRVSVLSKHPVRGAAPA
PVSPA
selected fasta
>hypothetical protein [hypothetical protein]
ATGGGGGTGATGATAGGACCCGCCGGAAGAGAGCGCGACGAAGGAGACCACGTGACACAG
CAGGCCCCGGTGGCGACGGACGAGCGGCGGGTCTTCGTCGACAAGCAGACCCCCGGCGCG
TACAAAGCGTTCGTGGCCGCGGCGGAATCGGTGCGGGAGGCCGCCGCGGCGGCCGGCCTG
GACCGCCTCCTCGTGGAACTGGTGAACATCCGCGTCTCCCAACTCAATGCCTGTGCCTAC
TGTCTCAGTCTGCACACCAGGGCGGCGCTGCGGGCCGGCGAGACGACCCAGCGCCTGGCG
GTGCTGCCCGCCTGGCGGGACACCGAGCTGTTCACCGCTCGGGAGCGGGCGGCGCTCGCC
CTCGCGGAGGCGACCACCCGTCCGGCGGACGCCGCCGCGCAGAGCGCCGCCTACGCGCAG
GCACGGGGCGTCCTGTCGGACGACGAGGTCTCCGCCGTGATCTGGGTGGCGATCAGCATC
AACGCCTTCAACCGGGTCTCCGTCCTGAGCAAGCACCCGGTGCGCGGCGCCGCACCCGCT
CCCGTGTCGCCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [40-124]  1.2e-17 PF02627
PF02627   CMD
IPR004675 Alkylhydroperoxidase AhpD core (Domain)
 [59-107]  9e-19 TIGR00778
TIGR00778   AhpD_dom
SignalP No significant hit
TMHMM No significant hit