close all open/close all

CDS information : Borre_00070


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction6,567 / 7,538 / + [in whole cluster]
6,567 / 7,538 / + [in contig]
Location6567..7538 [in whole cluster]
6567..7538 [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORFB7
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSNTETRPAEMRCGALEDEVPAAGVEVLTARDVPLGGPRAMTVRRTLPQRARTLIGAWCF
ADHYGPDDVAASGGMDVAPHPHIGLQTVSWLFSGEIEHRDSLGTHAFVRPGELNLMTGGF
GIAHSEVSTPDTTVLHGVQLWVALPEEHRDTGRDFQHHAPAPVAFDGGTARVFLGSLAGD
TSPVSTFTPLLGAELTLVPGGTATLDVDPGFEHGVLVDSGDVRVEGAVVRPAELGYVAPG
RATLTLTNESAAPARLILLGGPPFPEEIIMWWNFIGRSHDEIVRAREDWMKGDRFGEVHG
YDGAPLPAPELPNAPLKPRRRAR
selected fasta
>hypothetical protein [hypothetical protein]
GTGAGCAACACGGAGACACGGCCCGCGGAGATGCGGTGCGGCGCCCTCGAAGACGAGGTG
CCCGCCGCGGGCGTCGAAGTCCTCACCGCCCGTGACGTCCCCCTCGGCGGCCCGCGCGCC
ATGACCGTGCGGCGCACGCTGCCCCAGCGGGCCCGGACGCTGATCGGAGCCTGGTGCTTC
GCCGACCACTACGGTCCCGACGACGTGGCCGCGTCGGGCGGCATGGACGTCGCCCCGCAC
CCGCACATCGGCCTGCAGACGGTCAGCTGGCTGTTCAGCGGGGAGATCGAGCACCGGGAC
AGCCTCGGCACCCACGCCTTCGTCAGGCCCGGCGAACTCAACCTGATGACCGGCGGCTTC
GGCATCGCCCACTCCGAGGTCTCGACCCCCGACACCACTGTCCTGCACGGCGTCCAGCTC
TGGGTGGCGCTGCCGGAGGAGCACCGCGACACCGGCCGCGACTTCCAGCACCACGCACCC
GCGCCGGTCGCCTTCGACGGCGGCACGGCACGCGTCTTCCTCGGCTCGCTCGCCGGGGAC
ACCTCGCCCGTGAGCACCTTCACGCCGCTGCTGGGCGCCGAGTTGACGCTGGTGCCGGGC
GGCACCGCCACCCTGGACGTCGACCCCGGCTTCGAGCACGGCGTCCTCGTCGACAGCGGT
GACGTACGCGTCGAGGGCGCCGTCGTGCGACCGGCCGAACTGGGCTACGTCGCGCCGGGT
CGCGCGACGCTGACCCTGACCAACGAGTCGGCCGCACCCGCCCGGCTCATCCTCCTCGGC
GGCCCCCCGTTCCCCGAGGAGATCATCATGTGGTGGAACTTCATCGGCCGGTCGCACGAC
GAGATCGTGCGGGCCCGCGAGGACTGGATGAAGGGCGACCGCTTCGGCGAGGTGCACGGC
TACGACGGGGCACCCCTGCCCGCGCCGGAACTGCCGAACGCACCCTTGAAGCCGCGACGA
AGGGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003829 Pirin, N-terminal domain (Domain)
 [42-142]  1.4e-31 PF02678
PF02678   Pirin
IPR008778 Pirin, C-terminal domain (Domain)
 [194-292]  8.1e-17 PF05726
PF05726   Pirin_C
IPR011051 RmlC-like cupin domain (Domain)
 [22-309]  2.50000909916183e-68 SSF51182
SSF51182   RmlC_like_cupin
IPR012093 Pirin (Family)
 [22-299]  1.19999063421924e-96 PIRSF006232
PIRSF006232   Pirin
IPR014710 RmlC-like jelly roll fold (Domain)
 [34-268]  1e-60 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit