close all open/close all

CDS information : Borre_00080


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction8,397 / 7,603 / - [in whole cluster]
8,397 / 7,603 / - [in contig]
Locationcomplement(7603..8397) [in whole cluster]
complement(7603..8397) [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase type II
Gene
Gene (GenBank)borB
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase type II]
MTGTNTHSDVWIRQYRPAHPTAPQLICLPHAGGSATFYHPVAAALAPRCDVLAVQYPGRQ
DRRAEKPLEDIDELANQLFPVLRARVHQPVALFGHSMGATLAFELARRFESAGISLEALL
VSARPAPSRQRTGGTVHLLSDEELVAELRTLDGTAEQVFHDEELVRMALPAIRGDYRAAE
TYRYRPGPKLRCPIHALTGDDDPMVTPVEARAWSEHTDGPFTLDTFAGGHFYLLEHRDAI
LGIIAEHLRTCSRAPGDRSGLTRE
selected fasta
>putative type II thioesterase [thioesterase type II]
ATGACCGGTACGAACACCCACAGCGACGTGTGGATCAGGCAGTACCGCCCCGCACATCCC
ACGGCACCCCAGTTGATCTGTCTGCCGCACGCCGGCGGCTCCGCGACGTTCTACCACCCC
GTGGCTGCCGCGCTGGCACCCCGGTGCGACGTGCTCGCGGTCCAGTACCCCGGCCGGCAG
GACCGGCGCGCGGAGAAGCCCCTGGAGGACATCGACGAACTCGCGAACCAGCTCTTCCCC
GTGCTGCGGGCCCGTGTTCACCAGCCGGTCGCGCTGTTCGGACACAGCATGGGCGCCACC
CTCGCCTTCGAACTGGCCCGACGGTTCGAGAGTGCGGGCATCTCCCTGGAGGCACTCCTC
GTCTCGGCCAGGCCCGCACCGTCCCGGCAGAGGACGGGGGGTACGGTGCACCTCCTGTCG
GACGAGGAGTTGGTGGCCGAGCTGAGGACCCTCGACGGCACCGCGGAGCAGGTCTTCCAC
GACGAGGAGCTGGTGCGTATGGCCCTCCCCGCCATCCGCGGCGACTACAGGGCCGCCGAG
ACCTACCGCTACCGACCGGGCCCGAAGCTGCGGTGCCCCATCCATGCCTTGACCGGGGAT
GATGACCCGATGGTCACCCCGGTCGAGGCCCGGGCATGGTCCGAACACACGGACGGCCCG
TTCACACTCGACACCTTCGCGGGTGGTCACTTCTACCTGCTGGAGCACCGGGATGCGATT
CTCGGCATCATCGCCGAGCATCTGCGCACGTGCTCACGCGCTCCCGGCGACCGTTCGGGA
CTCACCCGAGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [24-247]  1.29999999999998e-59 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit