close all open/close all

CDS information : Borre_00090


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction9,194 / 8,397 / - [in whole cluster]
9,194 / 8,397 / - [in contig]
Locationcomplement(8397..9194) [in whole cluster]
complement(8397..9194) [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative oxidoreductase
Product (GenBank)putative ketoreductase
Gene
Gene (GenBank)borC
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
Q9LBG2
PmId
[11388460] Cloning, sequence analysis, and expression in Escherichia coli of the gene encoding monovalent cation-activated levodione reductase from Corynebacterium aquaticum M-13. (Biosci Biotechnol Biochem. , 2001)
[10508066] Purification and characterization of monovalent cation-activated levodione reductase from Corynebacterium aquaticum M-13. (Appl Environ Microbiol. , 1999)
[12621044] The crystal structure and stereospecificity of levodione reductase from Corynebacterium aquaticum M-13. (J Biol Chem. , 2003)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative ketoreductase]
MSLELTDRVMMVTGAGSGIGRAAARLLVGHGARVVLVGRTESALTETTAGLPSSHHLVVP
CDVGDDKQVADCVARAVSRFGRLDGAFNNAGTFGSFGPLHQDTADNFDRVIATNLRGVWS
CMRGQIEAMLTAGGGAIVNCASVAGHIGHAQSPLYSATKHAVIGLSKSVALQYAGDGIRV
NVVSPGSTDTPMLRSLYADPSALAQRARRAPLGRLGKCEEVANAVVWLLSPLAAYVTGQT
LGVDGGVTAGSAIPRTNATPEGQHR
selected fasta
>putative oxidoreductase [putative ketoreductase]
ATGAGTCTGGAACTCACCGACCGCGTGATGATGGTCACCGGAGCGGGCAGCGGCATCGGC
CGGGCCGCGGCCCGGCTCCTCGTGGGGCACGGAGCACGCGTCGTCCTGGTGGGCCGCACC
GAGTCGGCCCTCACGGAGACAACCGCCGGACTACCCTCCTCGCACCACTTGGTGGTGCCC
TGCGACGTCGGTGACGACAAGCAGGTGGCGGACTGCGTGGCCCGGGCGGTGAGCCGGTTC
GGACGGCTGGACGGGGCGTTCAACAACGCCGGGACCTTCGGCTCGTTCGGTCCGCTGCAC
CAGGACACCGCCGACAACTTCGACCGCGTGATCGCCACCAACCTGCGTGGGGTCTGGTCG
TGCATGCGCGGACAGATCGAGGCCATGCTGACGGCCGGCGGCGGCGCGATCGTGAACTGC
GCATCAGTGGCCGGGCACATCGGCCACGCCCAGAGCCCGCTCTACTCGGCCACCAAGCAC
GCGGTCATCGGCCTGAGCAAGTCGGTGGCCCTGCAGTACGCGGGCGACGGCATCCGCGTC
AACGTGGTCAGCCCCGGTTCGACCGACACCCCCATGCTGCGCAGCCTGTACGCCGATCCC
AGCGCCCTCGCACAACGGGCGCGCCGGGCTCCGCTGGGCCGCCTGGGCAAGTGCGAGGAG
GTGGCCAACGCGGTCGTCTGGCTGCTCAGCCCCCTCGCCGCCTACGTCACCGGGCAGACC
CTCGGGGTCGACGGAGGCGTCACGGCCGGATCGGCCATCCCCCGCACCAACGCCACGCCG
GAAGGGCAGCACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [9-173]  5.89999999999994e-33 PF00106
PF00106   adh_short
 [81-92]  1.20000117458134e-09 PR00080 [135-143]  1.20000117458134e-09 PR00080 [155-174]  1.20000117458134e-09 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [9-26]  4.19999771339582e-42 PR00081 [81-92]  4.19999771339582e-42 PR00081 [129-145]  4.19999771339582e-42 PR00081 [155-174]  4.19999771339582e-42 PR00081 [176-193]  4.19999771339582e-42 PR00081 [211-231]  4.19999771339582e-42 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [3-249]  3.79999999999991e-84 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-24]  0.171 Signal
Bacteria, Gram-negative   
TMHMM No significant hit