close all open/close all

CDS information : Borre_00110


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction11,165 / 9,993 / - [in whole cluster]
11,165 / 9,993 / - [in contig]
Locationcomplement(9993..11165) [in whole cluster]
complement(9993..11165) [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative cyclase
Product (GenBank)putative muconate cyclo-isomerase/lactamase
Gene
Gene (GenBank)borE
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
O34508
PmId
[11747447] Evolution of enzymatic activities in the enolase superfamily: functional assignment of unknown proteins in Bacillus subtilis and Escherichia coli as L-Ala-D/L-Glu epimerases. (Biochemistry. , 2001)
[11747448] Evolution of enzymatic activities in the enolase superfamily: crystal structures of the L-Ala-D/L-Glu epimerases from Escherichia coli and Bacillus subtilis. (Biochemistry. , 2001)
ACC
Q44244
PmId
[14705949] Evolution of enzymatic activity in the enolase superfamily: functional studies of the promiscuous o-succinylbenzoate synthase from Amycolatopsis. (Biochemistry. , 2004)
[15134446] Evolution of enzymatic activity in the enolase superfamily: structural studies of the promiscuous o-succinylbenzoate synthase from Amycolatopsis. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>putative cyclase [putative muconate cyclo-isomerase/lactamase]
MIRRVRLHTAVVPMAAAFDHATRSRRSAASLLVEIELAGTRGWGEGAPRDYVTGETLDGA
VRAVQACDPGELAERIEWRDFESAVASIAQLPLTGLVDGSSAAAAVEIALLDAVCRHFAR
PLADVLRVLAPPARSRRDGPTSVSLVIHLSRDVATVLDALTPRALAALRHVKIKVADPAG
AVDRLTAAQDRLPADTRVSLDVNGAWTAEEAEKVAGELDGVGWVEEPLPPRSWPELGRLR
RATGLPVMLDESCTGPADLHAAATSGAASHINVRLSKCGGFLAAARLALRADELGVGCQL
GVHVAEVGPLWAAGRTLATAWDLWQTVEAGRADEWFPVPLTTPAFTVDRSLHRVEPLTGP
GTGIEPTEELLRHTRCAATWESGGGWRRNT
selected fasta
>putative cyclase [putative muconate cyclo-isomerase/lactamase]
GTGATCCGTCGCGTACGGCTGCACACCGCCGTCGTGCCCATGGCCGCGGCCTTCGACCAC
GCCACGCGCTCCCGTCGCAGCGCGGCGTCCCTGCTGGTCGAGATCGAGCTGGCGGGCACC
CGCGGATGGGGAGAGGGAGCGCCCCGCGACTACGTCACCGGTGAGACCCTGGACGGCGCG
GTGCGAGCCGTCCAGGCCTGCGATCCCGGGGAGCTGGCCGAGCGCATCGAGTGGCGGGAC
TTCGAGAGCGCCGTCGCCTCGATCGCACAGCTGCCGCTGACCGGGCTCGTCGACGGCTCG
TCGGCGGCGGCCGCCGTGGAGATCGCCCTGCTCGACGCGGTGTGCCGGCATTTCGCCCGG
CCGCTCGCCGACGTCCTGCGGGTCCTGGCCCCGCCTGCCCGATCACGGCGGGACGGACCG
ACGTCCGTCAGCCTCGTGATCCACCTCTCGCGCGACGTCGCGACCGTCCTGGACGCACTC
ACGCCGCGGGCGCTGGCGGCGTTGCGGCACGTGAAGATCAAGGTGGCGGACCCGGCCGGG
GCGGTGGACCGGCTGACGGCGGCCCAGGACCGCCTCCCCGCCGACACCCGTGTCTCACTG
GACGTCAACGGCGCCTGGACGGCCGAGGAAGCGGAGAAGGTCGCGGGCGAACTGGACGGC
GTGGGGTGGGTGGAGGAGCCGCTCCCGCCGCGGTCCTGGCCCGAGTTGGGCCGGCTGCGG
CGGGCCACCGGTCTGCCCGTCATGCTCGACGAGTCCTGTACCGGACCGGCCGACCTCCAC
GCCGCCGCCACCAGCGGCGCCGCCAGCCACATCAACGTACGGCTGTCGAAGTGCGGCGGG
TTCCTCGCCGCGGCACGCCTGGCACTGCGCGCCGACGAGCTCGGCGTCGGTTGCCAGCTC
GGCGTTCACGTGGCCGAGGTGGGGCCGCTGTGGGCGGCCGGGCGCACCCTGGCCACCGCA
TGGGACCTGTGGCAGACGGTCGAGGCGGGCCGGGCCGACGAGTGGTTCCCCGTGCCACTG
ACCACGCCGGCGTTCACCGTCGACCGGTCACTGCACCGGGTCGAACCCTTGACCGGTCCG
GGCACGGGCATCGAACCGACCGAAGAACTACTGCGACACACCCGGTGCGCGGCCACCTGG
GAATCCGGCGGCGGCTGGCGGAGGAACACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013342 Mandelate racemase/muconate lactonizing enzyme, C-terminal (Domain)
 [184-250]  2.3e-14 PF01188
PF01188   MR_MLE
 [154-246]  5.90000104995095e-16 SM00922
SM00922   MR_MLE
SignalP
 [1-24]  0.584 Signal
Eukaryota   
 [1-28]  0.422 Signal
Bacteria, Gram-positive   
TMHMM No significant hit