close all open/close all

CDS information : Borre_00120


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction11,980 / 11,162 / - [in whole cluster]
11,980 / 11,162 / - [in contig]
Locationcomplement(11162..11980) [in whole cluster]
complement(11162..11980) [in contig]
TypeCDS
Length819 bp (272 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative esterase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)borF
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Related Reference
ACC
O35678
PmId
[9341166] cDNA cloning, tissue distribution, and identification of the catalytic triad of monoglyceride lipase. Evolutionary relationship to esterases, lysophospholipases, and haloperoxidases. (J Biol Chem. , 1997)

close this sectionSequence

selected fasta
>putative esterase [hypothetical protein]
MPTTSMLTAADGTGLTLHHWTTPGATSAVFYLHGIQSHAGWLFETGPELNARGIDVYALD
RRGSGRSEGPRGHLPSADLVLDDYARALDAVTAEVGGAGPVALGQSLGGSVLAALWCTRD
LPVRRLVLCAPALGQQRARHTADTLAERRALTGSGLRPVGLADGDYTDLPRYREFLTGDH
LMLREVTSATQATLVHLEDHYARGAPRTRLPVDLALPTHDPIIDLSAARAMLRRLTSAVH
EEVFATDRHYVEFTSARTAYWDWLATRLKEEA
selected fasta
>putative esterase [hypothetical protein]
ATGCCCACCACGAGCATGCTGACCGCTGCCGACGGCACCGGGCTCACCCTGCACCACTGG
ACCACGCCCGGCGCCACCTCGGCCGTCTTCTACCTCCACGGCATCCAGAGCCACGCGGGC
TGGCTGTTCGAGACGGGGCCCGAGCTCAACGCACGCGGCATCGACGTCTACGCCCTGGAC
CGCAGAGGCTCGGGCCGCAGCGAGGGGCCTCGCGGCCACCTGCCGTCGGCCGATCTCGTC
CTCGACGACTACGCCCGCGCCCTCGACGCCGTGACGGCCGAGGTCGGCGGTGCCGGGCCG
GTCGCCCTGGGGCAGAGCCTCGGCGGCAGCGTGCTGGCCGCGCTCTGGTGCACCCGCGAT
CTGCCCGTCCGCAGGTTGGTCCTGTGCGCGCCCGCGCTGGGACAGCAGCGGGCGCGCCAC
ACCGCGGACACGCTCGCCGAGCGCCGCGCGCTCACCGGCAGCGGGCTACGGCCCGTGGGG
CTCGCCGACGGCGACTACACCGACCTGCCGCGCTACCGGGAGTTCCTCACCGGGGATCAC
CTGATGCTGCGCGAGGTCACCTCGGCCACGCAGGCGACGCTCGTGCACCTGGAGGACCAC
TATGCCCGCGGTGCCCCCCGCACCCGGCTCCCCGTCGACCTGGCGCTCCCCACTCACGAC
CCGATCATCGACCTGTCGGCCGCGCGAGCGATGCTGCGGCGTCTGACGTCAGCCGTGCAC
GAGGAGGTCTTCGCCACGGATCGGCACTACGTGGAGTTCACGTCGGCCCGGACGGCGTAC
TGGGACTGGCTGGCCACGCGGCTGAAGGAGGAAGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-39]  0.332 Signal
Bacteria, Gram-negative   
TMHMM No significant hit