close all open/close all

CDS information : Borre_00140


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction15,659 / 13,608 / - [in whole cluster]
15,659 / 13,608 / - [in contig]
Locationcomplement(13608..15659) [in whole cluster]
complement(13608..15659) [in contig]
TypeCDS
Length2,052 bp (683 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
ProductCoA-transferase family protein
Product (GenBank)putative dehydratase
Gene
Gene (GenBank)borH
EC number
Keyword
  • trans-1,2-CPDA
Note
Note (GenBank)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
Family/Domain
FD
IPR003673

close this sectionSequence

selected fasta
>CoA-transferase family protein [putative dehydratase]
MRGARENSMTRAGPLEGIAVLMAGRSTPAALLGRLLADLGARVVTLCRSPDHGGPFERWL
HSAAQSASGWDQASRLLQTADVLVCDAEGDERLAALGLGAPELPHRSPELVAVRLSAFGL
TGPLRDAPATERTLQALAGLTSATGTEGEPSVLSVVGLASRTAALSGLIAVVAGLIGRER
GGGGDYLDIAEFDSLFTLTGTLLPSVALAGRPPRRTGNRHGMAAPWNSYTCQDAPVVICT
MGEPIWHRLTAVLGRRDLPDDPRFADTAARVRNADELDEILGKWTAGQRAVDVVTALRAA
GIPCAQVAAPEEVRDGAAARRRGLVTDPSGTPGSPLRSLIPAVTDGPMPRQGGLWEPIAR
GTPPLRGVRLLEVGSYTAGPHAGRLLAQLGADVLKVEPPHGEGSRRLAQQVAGVGYLYYV
NNAGKRSCRLDLADAEDRAGFERLLAGCDIVLTNLAADTLTAQGLAPDQILSRHGVVHCT
VTGHGLAAADRSVDTVIQAESGIMRLVGGPGAGLRTPVSSADVLGAYLAAAAAVVSTYVR
LRTEHGCAADVALFDSAVWLTQDRWFTAPPARAPHLVRAADGTVLVDAEGPPPRAEGPVA
AVLDAAAAVGVPAAPLHDLTRAVRHPQVLARRMAVARDCAGTTVLITGNHLRSLLREDPP
PTCAPVDQNDPVWLQPAPTEGQQ
selected fasta
>CoA-transferase family protein [putative dehydratase]
GTGCGCGGAGCGAGGGAGAATTCCATGACAAGGGCAGGGCCGCTCGAGGGCATCGCCGTA
CTCATGGCCGGCCGCAGTACACCAGCCGCACTGCTGGGGAGACTGCTCGCGGACCTCGGG
GCACGTGTCGTGACGCTCTGCCGATCACCCGATCACGGGGGCCCGTTCGAGCGGTGGCTG
CACTCCGCCGCGCAGTCGGCGTCCGGTTGGGACCAGGCATCGCGTCTGCTGCAGACGGCC
GATGTGCTGGTGTGCGACGCGGAGGGCGATGAGCGGCTCGCCGCTCTGGGGCTCGGGGCG
CCGGAACTTCCGCATCGCAGCCCCGAGTTGGTCGCGGTGCGGCTGAGCGCGTTCGGGCTC
ACCGGCCCGCTGCGTGACGCCCCGGCCACCGAGCGGACCTTGCAGGCGCTGGCGGGCCTG
ACCTCGGCGACCGGCACCGAGGGGGAACCATCGGTCCTCTCCGTGGTGGGCCTGGCGTCG
CGTACGGCGGCCCTGTCCGGTCTGATCGCCGTCGTGGCCGGGCTCATCGGCCGCGAGCGC
GGAGGAGGCGGGGACTACCTGGACATCGCCGAGTTCGACAGCCTGTTCACTCTGACGGGC
ACCTTGCTTCCGAGCGTCGCGCTCGCCGGTCGTCCGCCACGTCGTACCGGCAACCGACAC
GGCATGGCGGCACCCTGGAACAGCTACACGTGCCAGGACGCCCCTGTCGTCATCTGCACG
ATGGGCGAGCCGATATGGCACAGGCTGACCGCAGTCCTGGGACGACGGGACCTCCCCGAC
GACCCTCGCTTCGCCGACACCGCCGCCCGCGTCCGCAACGCCGACGAGCTCGACGAGATC
CTCGGCAAGTGGACCGCCGGGCAGCGGGCCGTGGACGTGGTGACCGCCCTGCGGGCCGCC
GGCATCCCGTGCGCCCAGGTCGCGGCCCCCGAGGAGGTACGCGACGGAGCCGCCGCCCGG
CGTCGCGGCCTGGTCACCGACCCGTCCGGTACACCGGGCAGCCCACTGCGTTCCCTCATA
CCCGCCGTCACCGACGGTCCGATGCCCCGGCAGGGCGGCCTCTGGGAGCCGATCGCGCGC
GGCACTCCTCCGCTGCGCGGCGTCCGCCTGCTGGAGGTCGGCTCGTACACGGCCGGACCG
CACGCGGGCCGGCTGCTGGCCCAACTCGGCGCCGACGTACTGAAGGTGGAGCCGCCGCAC
GGCGAAGGGTCCCGGCGGCTCGCCCAGCAGGTGGCCGGGGTCGGCTACCTCTACTACGTC
AACAACGCGGGCAAACGCTCCTGTCGGCTCGACCTCGCCGACGCCGAGGACCGGGCCGGG
TTCGAGCGGCTGCTCGCCGGATGCGACATCGTGCTCACCAACCTCGCGGCCGACACACTC
ACCGCGCAGGGCCTCGCCCCCGATCAGATCCTGTCCCGGCACGGCGTCGTGCACTGCACG
GTCACCGGCCATGGCCTGGCCGCCGCCGACCGCAGCGTCGACACCGTGATCCAGGCCGAG
TCGGGCATCATGCGCCTCGTCGGCGGCCCGGGCGCCGGGCTGAGGACTCCAGTGTCCAGC
GCCGACGTCCTCGGTGCCTACCTGGCCGCTGCCGCCGCCGTCGTGTCCACCTACGTCCGT
CTGCGCACCGAGCACGGATGCGCCGCCGACGTCGCGCTGTTCGACAGCGCTGTCTGGCTC
ACCCAGGACCGCTGGTTCACCGCCCCACCCGCACGGGCCCCCCACCTCGTCCGGGCGGCG
GACGGCACGGTCCTCGTCGACGCGGAAGGCCCGCCACCGCGGGCCGAGGGCCCCGTCGCC
GCCGTACTGGACGCGGCGGCAGCCGTCGGCGTGCCCGCGGCCCCGCTGCACGACCTGACC
CGCGCGGTGCGGCACCCCCAAGTTCTCGCCCGGCGGATGGCCGTCGCCCGGGACTGCGCC
GGAACCACCGTGCTCATCACCGGCAACCACCTGCGTTCCCTGCTCCGCGAGGACCCGCCA
CCCACCTGCGCGCCGGTCGACCAGAACGATCCCGTCTGGCTCCAGCCCGCCCCGACCGAG
GGACAGCAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [66-249]  3.29999999999997e-35 PF02515 [429-567]  7.20000000000003e-26 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [11-351]  8.10000734323267e-67 SSF89796 [361-683]  3.99998544139406e-53 SSF89796
SSF89796   CoA-Trfase_fam_III
 [7-305]  2.59999999999995e-104 G3DSA:3.40.50.10540 [361-568]  2.59999999999995e-104 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   CoA-Trfase_fam_III
SignalP No significant hit
TMHMM No significant hit