close all open/close all

CDS information : Borre_00150


close this sectionLocation

Organism
StrainTü4055
Entry nameBorrelidin
Contig
Start / Stop / Direction16,184 / 18,814 / + [in whole cluster]
16,184 / 18,814 / + [in contig]
Location16184..18814 [in whole cluster]
16184..18814 [in contig]
TypeCDS
Length2,631 bp (876 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)borrelidin polyketide synthase, type I
Gene
Gene (GenBank)borA1
EC number
Keyword
Note
Note (GenBank)
  • Loading module (acyltransferase, acylcarrier protein)
Reference
ACC
PmId
[15112998] Biosynthesis of the angiogenesis inhibitor borrelidin by Streptomyces parvulus Tu4055: cluster analysis and assignment of functions. (Chem Biol. , 2004)
[14651102] Evidence from engineered gene fusions for the repeated use of a module in a modular polyketide synthase. (Chem Commun (Camb). , 2003)
[25188840] In vitro analysis of carboxyacyl substrate tolerance in the loading and first extension modules of borrelidin polyketide synthase. (Biochemistry. , 2014)

close this sectionPKS/NRPS Module

0
AT322..642
ACP694..767

close this sectionSequence

selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
MTGSAVSAPFLQPPEPVSGHSERKSDPVLLVGAGRRARMADAVRAAGAQAGIDPAVLRRT
RATLITAGSAGAAGRLAAALRLTGATISLDTRETPTLLALHLAAQALRAGDTSYAVVGAE
LPDGNCALILARQSAATAEGAVPQAIVRTTTADRTTTADHAPAPDDHGSPAREAPHATRT
LSPGITQAPAEGFPGLLATLHDDTPLRPTAVTEHGSDATTVLVLLDQPQDAAPAAPLPWV
VSAPHTRALRATAATLAVHLDTTPAAPADVAHTLLTARPDRHRAAVVGADRATLTDGLRA
LATGGDAPHLVHGTATGSPRPVFVFPGQGSQWPGMAAELLETSEPFHDSVHACADALAEF
VDWSVLDVLRQAPDAPPLRRVDVLQPTLWATMVSLAEVWRSYGVEPAAVVGHCCGEIAAA
QVAGALDMRDAARLLAHRSRAWLRLVGKGTVISVATSGQDITRRMAAWPDSVELAALNGP
RSVALAGPPDVLDGIVNDLTDQGIHAKRIPGVDTVGHCSQVEVLRDHLLDVLRPVSPRPA
AVPFYSTVDGTERDTTTLDTDYWYLNTRSQVRFHQAVRNLLAAGHRSFVEVSPHPLLGAS
IEDTAAEFGLDDVAAVGTLRRGQGGTRRVLTSVAEAYVHGIDIDFTPAFTGTTPNRIDLP
TVEDHGIEGHGDDGGETWTDRVRTLPDEQREEALLDLVCRTVAAVLEADPAGTADAVAPD
TAFKEMGLGSLSAVRLRNGLREATGAHLPATIAYDHPTPAALARHLAMTLFDATGAAPAV
PAPSRDDEPIDAETAVLTALERADEALERLRAPHARTPRQETGRRIDELLRSLTDKARRM
RQADAVDDVDDPATDRFAAATDDEMFELLEKRFGIS
selected fasta
>polyketide synthase [borrelidin polyketide synthase, type I]
ATGACAGGCAGTGCTGTTTCGGCCCCATTCCTGCAGCCTCCCGAACCCGTCTCAGGGCAC
TCCGAACGGAAAAGCGATCCCGTCCTTCTCGTCGGCGCCGGACGCCGTGCCCGCATGGCG
GATGCCGTACGTGCCGCCGGCGCTCAGGCGGGCATCGACCCGGCCGTCCTACGGCGCACC
CGGGCCACCTTGATCACCGCGGGGAGCGCGGGAGCCGCAGGCCGGCTCGCCGCCGCCCTG
CGCCTGACCGGCGCCACGATCTCTCTGGACACCCGCGAGACACCCACACTGCTCGCCCTG
CACCTCGCCGCCCAAGCGCTGCGGGCGGGCGACACCTCTTACGCCGTCGTCGGTGCCGAA
CTTCCCGACGGGAACTGCGCGTTGATCCTGGCCAGGCAGTCAGCGGCAACCGCCGAGGGG
GCTGTGCCCCAGGCGATCGTCCGCACCACCACGGCGGACCGCACCACCACGGCGGATCAC
GCCCCTGCGCCCGACGACCACGGCAGCCCGGCCCGTGAAGCCCCGCATGCCACCCGCACG
TTGTCCCCAGGCATCACCCAGGCCCCCGCCGAGGGCTTCCCGGGCCTGCTGGCGACCCTG
CACGACGACACACCCCTGCGCCCCACCGCGGTCACCGAGCACGGCAGCGACGCCACCACC
GTCCTCGTCCTCCTCGACCAGCCCCAGGACGCCGCACCCGCGGCACCGCTCCCCTGGGTG
GTCTCGGCCCCCCACACCCGCGCCCTCCGGGCCACGGCCGCGACCCTGGCCGTCCACCTC
GACACCACACCGGCCGCACCCGCCGACGTCGCGCACACCCTGCTCACCGCGCGCCCCGAC
CGCCACCGTGCCGCCGTCGTCGGCGCGGACCGGGCCACCCTCACCGACGGACTGCGCGCA
CTCGCCACCGGAGGCGACGCGCCCCACCTCGTCCACGGCACCGCCACCGGATCGCCGCGT
CCCGTCTTCGTCTTCCCCGGCCAGGGGTCGCAGTGGCCCGGTATGGCCGCCGAACTCCTC
GAAACCAGCGAGCCCTTTCACGACAGCGTGCACGCTTGCGCCGACGCGCTGGCCGAGTTC
GTCGACTGGTCGGTTCTCGACGTCCTGCGCCAGGCACCGGACGCGCCACCCCTGCGCCGG
GTGGACGTTCTCCAGCCCACCCTGTGGGCGACGATGGTCTCCCTGGCCGAGGTCTGGCGC
TCGTACGGCGTGGAACCGGCCGCCGTCGTCGGCCACTGCTGCGGCGAGATCGCCGCCGCG
CAGGTAGCCGGCGCCCTCGACATGCGTGACGCCGCCCGACTGCTCGCCCACCGCAGCCGG
GCCTGGCTGCGACTGGTGGGCAAGGGCACGGTCATCTCCGTCGCCACCTCGGGACAGGAC
ATCACCCGGCGCATGGCGGCCTGGCCCGACTCCGTCGAACTGGCCGCGCTCAACGGCCCG
CGCTCCGTGGCGCTCGCAGGCCCGCCCGACGTCCTGGACGGCATCGTCAACGACCTGACC
GACCAGGGCATCCACGCCAAACGCATCCCCGGCGTGGACACCGTCGGCCACTGCTCCCAG
GTCGAGGTCCTCCGCGACCACCTGCTGGACGTCCTGCGCCCGGTCTCGCCCCGGCCCGCC
GCCGTGCCGTTCTACTCCACCGTCGACGGAACCGAACGCGACACCACCACGCTGGACACC
GACTACTGGTACCTCAACACCCGCAGCCAGGTCCGCTTCCACCAGGCCGTGCGGAACCTG
CTCGCCGCCGGACACCGCTCGTTCGTCGAGGTGAGCCCGCACCCGCTGCTCGGAGCCTCC
ATCGAGGACACCGCGGCCGAGTTCGGCCTCGACGACGTGGCCGCCGTCGGCACCCTGCGT
CGAGGCCAGGGCGGCACCCGCCGGGTCCTGACCTCGGTGGCGGAGGCGTATGTCCACGGC
ATCGACATCGACTTCACGCCCGCCTTCACCGGCACGACCCCCAACCGCATCGACCTTCCG
ACCGTCGAGGACCACGGCATCGAGGGTCACGGCGACGACGGCGGCGAGACATGGACCGAC
CGCGTCAGAACCCTCCCGGACGAGCAGCGCGAAGAGGCTTTGCTGGACCTCGTGTGCCGC
ACCGTCGCCGCGGTGCTCGAAGCGGACCCGGCCGGCACGGCGGACGCCGTCGCCCCCGAC
ACGGCGTTCAAGGAGATGGGCCTCGGCTCACTGAGCGCGGTCCGGCTGCGCAACGGCCTC
CGCGAGGCCACCGGCGCCCACCTGCCGGCCACCATCGCCTACGACCACCCCACCCCGGCC
GCTCTGGCCCGCCACCTGGCGATGACCCTGTTCGACGCGACGGGCGCCGCCCCGGCGGTC
CCGGCACCGAGCCGCGACGACGAACCGATCGACGCCGAGACCGCTGTGCTGACCGCGCTG
GAACGGGCCGACGAGGCGCTGGAACGGTTGCGGGCCCCGCACGCCCGCACGCCCCGGCAG
GAGACCGGCCGGCGGATCGACGAGCTGCTGCGGTCCCTGACCGACAAGGCCAGGCGGATG
AGACAGGCCGACGCCGTCGATGATGTCGATGATCCGGCCACCGACCGGTTCGCCGCAGCC
ACCGACGACGAGATGTTCGAACTCCTCGAGAAACGTTTCGGCATCTCCTGA
[0] AT322..642
[0] ACP694..767
[0] AT964..1926
[0] ACP2080..2301

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [313-445]  7.90000000000016e-67 G3DSA:3.40.366.10 [514-632]  7.90000000000016e-67 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [686-784]  5.79999653854781e-20 SSF47336
SSF47336   ACP_like
 [698-766]  3.90000000000001e-10 PF00550
PF00550   PP-binding
 [694-767]  PS50075
PS50075   ACP_DOMAIN
 [692-768]  1.8e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [60-119]  2.3e-06 PF00109
PF00109   ketoacyl-synt
IPR014043 Acyl transferase (Domain)
 [322-642]  2.99999999999998e-93 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [320-623]  9.19998414420354e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [447-513]  5.79999653854781e-10 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-119]  7e-08 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-141]  2.6999988713206e-07 SSF53901
SSF53901   Thiolase-like
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [324-623]  1.59998835313644e-90 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [695-770]  1.10000150671642e-22 SM00823
SM00823   PKS_PP
SignalP
 [1-19]  0.061 Signal
Eukaryota   
TMHMM No significant hit